Recombinant Salmonella paratyphi A Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
frdC; SSPA3862; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKHGAESWMGF VGFLQNPVVVILNLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKGLWVVTAVV TVVILYVALFW
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized during anaerobic growth, while succinate dehydrogenase is used during aerobic growth. FrdC anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links

KEGG: sek:SSPA3862

Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What is the role of frdC in the electron/proton transfer pathways of Salmonella paratyphi A?

FrdC plays a central role in the sophisticated electron/proton transfer mechanisms required for anaerobic respiration in S. paratyphi A:

Electron Transfer Pathway:
The membrane-embedded frdC subunit contains binding sites for quinones and heme groups that facilitate electron transfer. Research on QFR complexes from anaerobic bacteria reveals that one menaquinone molecule binds near heme bL in the hydrophobic subunit C . This bound menaquinone serves as an additional redox cofactor that mediates the proton-coupled electron transport across the membrane.

Quinol + Fumarate → Quinone + Succinate

This reaction couples electron transfer from quinol to fumarate with proton translocation across the membrane. The structural arrangement of frdC's transmembrane helices creates channels for proton movement during this process .

Spectroscopic and crystallographic studies of homologous QFR complexes suggest that electrons from quinol are transferred through heme groups within frdC to the iron-sulfur clusters in subunit B and ultimately to the FAD cofactor in subunit A, where fumarate reduction occurs.

  • How does frdC contribute to reactive oxygen species generation in Salmonella paratyphi A?

Research demonstrates that fumarate reductase is a major contributor to reactive oxygen species (ROS) generation in anaerobic bacteria . While most studies have been conducted on related bacteria, the mechanism likely applies to S. paratyphi A:

Mechanism of ROS Generation:
When exposed to oxygen, the fumarate reductase complex, particularly the frdC subunit with its electron-carrying components, can inadvertently transfer electrons to molecular oxygen instead of fumarate. This generates superoxide radicals (O₂⁻), which can be converted to hydrogen peroxide (H₂O₂) and other reactive oxygen species.

Experimental Evidence:
Studies in Bacteroides fragilis showed that:

  • Deletion of frdC significantly reduced H₂O₂ production

  • The frdC deletion mutant displayed increased aerotolerance in a superoxide dismutase-deficient background

  • Exogenous fumarate reduced H₂O₂ production in strains lacking key peroxide-detoxifying enzymes

In S. paratyphi A, this ROS generation may have dual effects:

  • Contributing to oxidative stress within the bacterium itself

  • Potentially enhancing tissue damage during infection

  • Modulating host immune responses through oxidative signaling

Research with C. elegans models confirmed that "S. Paratyphi A could increase oxidative stress and regulate the immune response" , suggesting that ROS generation mechanisms, potentially involving frdC, represent an important aspect of host-pathogen interactions.

  • What experimental methodologies can be used to study frdC function in Salmonella paratyphi A?

Genetic Approaches:

  • Gene knockout and complementation:

    • Lambda Red recombination for targeted frdC deletion

    • Complementation with wild-type frdC in trans to verify phenotypes

    • Growth analysis under aerobic versus anaerobic conditions

  • Site-directed mutagenesis:

    • Targeting conserved residues important for heme binding

    • Creating mutations that affect quinone binding sites

    • Altering transmembrane domains to study membrane integration

Biochemical Methods:

  • Enzyme activity assays:

    • Membrane vesicle preparation for in vitro fumarate reductase activity

    • Measuring quinol oxidation and fumarate reduction rates

    • Kinetic analysis with various substrates and inhibitors

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with other QFR subunits

    • Bacterial two-hybrid systems

    • Cross-linking experiments followed by mass spectrometry

Structural Analysis:

  • X-ray crystallography or cryo-electron microscopy

  • Hydrogen-deuterium exchange mass spectrometry

  • EPR spectroscopy to study heme environments

Cell Culture Models:
Following techniques described in source :

  • HeLa and Caco-2 epithelial cell infection models (MOI 1:50)

  • RAW264.7 macrophage infection (MOI 1:10)

  • Gentamicin protection assays for intracellular survival quantification

  • Comparing wild-type and frdC mutant strains for invasion and persistence

Animal Models:

  • C. elegans infection models as described in source

  • Mouse models of infection to assess virulence of frdC mutants

Omics Approaches:

  • RNA-seq to identify transcriptional changes in frdC mutants

  • Proteomics to detect altered protein expression patterns

  • Metabolomics to identify metabolic shifts in the absence of frdC

  • How does frdC contribute to the pathogenesis and virulence of Salmonella paratyphi A infections?

The contribution of frdC to S. paratyphi A pathogenesis involves several interconnected mechanisms:

Adaptation to Host Environments:
During infection, S. paratyphi A encounters various microenvironments with limited oxygen, particularly within macrophages and in intestinal tissues. The QFR complex containing frdC enables anaerobic respiration, providing a metabolic advantage for survival and replication in these niches .

Infection Process:
The pathogenesis of S. paratyphi A infection follows a specific trajectory where metabolic adaptation is critical:

  • Ingestion through contaminated food/water

  • Survival in the acidic stomach environment

  • Invasion of intestinal epithelial cells, especially M cells

  • Dissemination to mesenteric lymph nodes and bloodstream

  • Replication in phagocytes of spleen, liver, and bone marrow

FrdC-containing fumarate reductase likely supports bacterial metabolism during these stages, particularly during intracellular survival.

ROS-Mediated Tissue Damage:
The generation of reactive oxygen species by fumarate reductase may contribute to host tissue damage, potentially enhancing bacterial dissemination. Studies indicate that S. paratyphi A increases oxidative stress in infection models , which may be partially attributed to frdC activity.

Metabolic Signature:
Metabolomic studies have identified distinct metabolite profiles in patients with S. paratyphi A infections . These profiles reflect the unique metabolism of this pathogen, potentially influenced by anaerobic respiratory enzymes like the QFR complex.

Genome Structure Considerations:
The genome of S. paratyphi A contains unique rearrangements, including an inversion of half the genome between rrnH and rrnG and a 100-kb insertion between rrnH/G and proB . These genomic features may influence the expression and function of respiratory enzymes, including the frdC-containing QFR complex.

  • What is the potential role of frdC in the development of antimicrobial strategies against Salmonella paratyphi A?

FrdC represents a promising antimicrobial target due to its essential role in anaerobic metabolism and potential contribution to virulence:

Target Validation Approaches:

  • Genetic validation:

    • Creating conditional frdC mutants to confirm essentiality

    • Determining growth inhibition under various conditions

    • Assessing attenuation of virulence in frdC mutants

  • Chemical validation:

    • Testing known fumarate reductase inhibitors

    • Structure-activity relationship studies

    • Target engagement assays in whole cells

Drug Development Strategies:

  • Structure-based drug design:

    • Utilizing structural information about frdC and the QFR complex

    • Rational design of inhibitors targeting quinol binding sites

    • Computer-aided drug design approaches

  • High-throughput screening:

    • Development of cell-based or enzyme-based assays

    • Screening chemical libraries for inhibition of fumarate reductase activity

    • Counter-screens against human enzymes to ensure selectivity

Antimicrobial Mechanisms:

  • Direct inhibition of enzyme activity

  • Disruption of protein-protein interactions within the QFR complex

  • Prevention of heme incorporation

  • Interference with membrane integration

Addressing Antimicrobial Resistance:
With increasing antimicrobial resistance in S. paratyphi A , targeting metabolic pathways such as anaerobic respiration provides a novel approach that could circumvent existing resistance mechanisms. The genomic analysis reveals that while antimicrobial resistance genes are relatively rare in S. paratyphi A (only 2% of 1379 genomes analyzed contained resistance genes), mutations in the quinolone resistance-determining region (QRDR) are common (85% of genomes) , highlighting the need for new antibiotic targets.

  • How can recombinant frdC be utilized in vaccine development against Salmonella paratyphi A?

While current S. paratyphi A vaccine development has focused primarily on other antigenic targets, frdC represents a potential component for novel vaccine strategies:

Subunit Vaccine Approach:
Recombinant frdC could be formulated as a subunit vaccine component, similar to other membrane proteins of S. paratyphi A that have shown immunogenic potential. Research has demonstrated that several outer membrane proteins (LamB, PagC, TolC, NmpC, and FadL) conferred significant immunoprotection in mice with protection rates of 95%, 95%, 85%, 80%, and 70%, respectively .

Evaluation Process:

  • Immunogenicity assessment:

    • Animal immunization with purified recombinant frdC

    • Measurement of antibody titers and specificity

    • Assessment of T-cell responses

  • Protection studies:

    • Challenge experiments in appropriate animal models

    • Determination of bacterial loads in tissues

    • Survival analysis

Adjuvant Selection:
The hydrophobic nature of frdC would require careful adjuvant selection and formulation strategies to enhance immunogenicity and ensure proper protein presentation to the immune system.

Combination Approaches:
Given the progress with O-antigen conjugate vaccines for S. paratyphi A , frdC could potentially be incorporated into multicomponent vaccines combining:

  • O:2-CRM197 conjugates

  • Multiple protein antigens

  • Live attenuated vaccine platforms

For example, O:2-CRM197 conjugates have shown strong serum bactericidal activity against S. paratyphi A in mouse models, with immunized mice developing high levels of anti-OSP IgG with bactericidal properties . A similar approach could be explored with frdC, potentially as part of a broader antigen repertoire.

  • What genomic and evolutionary insights can be derived from studying frdC across Salmonella strains?

Genomic analysis of frdC across Salmonella strains provides valuable evolutionary insights:

Genomic Context:
The genome of S. paratyphi A features unique structural characteristics that may influence frdC expression and function:

  • An inversion of half the genome between rrnH and rrnG

  • A 100-kb insertion between rrnH/G and proB

  • These rearrangements are present in all wild-type S. paratyphi A strains tested

Evolutionary Conservation:
Genomic surveillance tools like Paratype have enabled comprehensive analysis of S. paratyphi A genomes, revealing population structure and evolutionary relationships . Analysis of 1379 S. paratyphi A genomes identified:

  • Three primary clades

  • Nine secondary clades

  • 18 distinct genotypes

While frdC-specific analysis is not directly mentioned, the conservation of essential metabolic genes across these genotypes would provide insights into selection pressures and functional constraints on respiratory proteins.

Comparative Analysis:
Comparing frdC sequences across:

  • Different Salmonella serovars

  • Isolates from different geographical regions

  • Clinical versus environmental isolates

  • Antimicrobial resistant versus susceptible strains

Such analysis could reveal correlations between frdC sequence variations and:

  • Virulence potential

  • Host adaptation

  • Metabolic capabilities

  • Geographic distribution

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.