Recombinant Salmonella paratyphi A Glutathione transport system permease protein gsiC (gsiC)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Salmonella Paratyphi A glutathione transport system permease protein GsiC (gsiC) is a key component of the glutathione uptake machinery in this pathogen. Glutathione (GSH) is critical for bacterial redox homeostasis, virulence, and stress resistance . The GsiC protein, encoded by the gsiC gene (locus SPA1905), forms part of the gsiABCD operon, which constitutes the ATP-binding cassette (ABC) transporter system responsible for GSH import . Recombinant production of GsiC enables functional studies of its role in bacterial physiology and pathogenesis.

Mechanism of Action

  • The GsiABCD system imports extracellular GSH into the cytoplasm, where it mitigates oxidative stress and supports virulence .

  • Key Steps:

    1. GsiA hydrolyzes ATP to energize transport.

    2. GsiC and GsiD form the transmembrane channel for GSH translocation .

Experimental Evidence

  • Knockout Studies: Deletion of gsiA (a partner gene) reduces glutathione uptake and attenuates Salmonella enterica virulence .

  • Binding Assays: Bacterial two-hybrid systems confirm direct interactions between GsiC, GsiA, and GsiD .

Key Uses

  • ELISA Development: Used as an antigen to generate antibodies .

  • Structural Biology: NMR/X-ray crystallography studies to resolve its transmembrane topology .

Role in Virulence

  • Redox Balance: GSH neutralizes host-derived reactive oxygen species (ROS), enhancing bacterial survival during infection .

  • Virulence Attenuation: Disruption of GSH transport reduces intracellular survival in macrophages .

Comparative Proteomics

  • Differential Expression: Salmonella Paratyphi A surface proteins, including transporters like GsiC, show distinct expression profiles compared to S. Typhi, potentially influencing host adaptation .

Challenges and Future Directions

  • Structural Resolution: Full 3D structure determination is pending, limiting mechanistic insights.

  • Therapeutic Targeting: Blocking GsiC could disrupt glutathione uptake, offering a novel antimicrobial strategy .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
gsiC; SPA1905; Glutathione transport system permease protein GsiC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
gsiC
Target Protein Sequence
MLNYVLKRLLGLIPTLLIVAVLVFLFVHLLPGDPARLIAGPEADAQVIALVRQQLGLDQP LHVQFWRYITHVLQGDFGTSMVSRRPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAA AVWRNRWPDRLGMTLAVTGISFPAFALGMLLMQIFSVDLGWLPTVGADSWQHYILPSLTL GAAVASVMARFTRSSFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMGLQFG FLLGGSIVVEKVFNWPGLGRLLVDSVDMRDYPVIQAEVLLFSLEFILINLVVDVLYAAIN PAIRYK
Uniprot No.

Target Background

Function
This protein is part of the ABC transporter complex GsiABCD, involved in glutathione import. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: spt:SPA1905

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is GsiC protein and what role does it play in Salmonella paratyphi A pathogenesis?

GsiC is a critical membrane permease protein encoded by the gsiC gene (locus SPA1905) that forms part of the GsiABCD ATP-binding cassette (ABC) transporter system. This system is specifically responsible for glutathione (GSH) import across the bacterial membrane. The entire GsiABCD system functions as an integrated complex that facilitates the uptake of extracellular glutathione into the cytoplasm, where it plays crucial roles in maintaining redox homeostasis and supporting virulence mechanisms.

The pathogenesis connection is significant because glutathione helps Salmonella neutralize host-derived reactive oxygen species (ROS), thus enhancing bacterial survival during infection. This protective mechanism allows Salmonella paratyphi A to persist within host phagocytes, particularly in the spleen, liver, and bone marrow, where it can replicate and cause serious lesions . Experimental evidence from knockout studies has demonstrated that disruption of glutathione transport reduces intracellular survival in macrophages, directly linking GsiC function to virulence capability.

How does the GsiABCD transport system's structure contribute to its functionality?

The GsiABCD system operates as a complete ATP-binding cassette (ABC) transporter, with each component serving distinct functional roles:

  • GsiA: ATP-binding protein that provides energy for transport through ATP hydrolysis

  • GsiB: Substrate-binding protein that recognizes and captures glutathione

  • GsiC: Transmembrane permease that forms the channel for glutathione passage

  • GsiD: Additional permease component that works with GsiC to create the transport pathway

The system's structural organization enables selective glutathione recognition and energy-coupled transport. Bacterial two-hybrid studies have confirmed direct physical interactions between GsiC, GsiA, and GsiD, demonstrating how these proteins assemble into a functional complex. The transmembrane topology of GsiC features multiple membrane-spanning domains that create a specific passage for glutathione molecules. Structural biology approaches including NMR and X-ray crystallography have been employed to resolve this topology in detail.

What genomic characteristics distinguish Salmonella paratyphi A strains that express GsiC?

Genomic surveillance of Salmonella paratyphi A has revealed considerable genetic diversity across global isolates. Using the Paratype genotyping tool, researchers have categorized Salmonella paratyphi A into three primary clades, nine secondary clades, and 18 distinct genotypes . This classification system is based on single nucleotide polymorphisms (SNPs) and provides a framework for tracking the evolution and spread of different strains.

Within this genetic diversity, expression profiles of surface proteins, including transporters like GsiC, show distinct patterns that potentially influence host adaptation. Analysis of 1,379 isolates collected between 1917 and 2019 identified 8,346 SNPs with minimal recombination events, suggesting relatively stable genetic features in proteins like GsiC . This genomic stability has positive implications for targeting GsiC in vaccine development strategies, as the protein's conserved nature makes it a potentially reliable antigen across different Salmonella paratyphi A strains.

How do knockout models of GsiC affect glutathione homeostasis and virulence?

Knockout studies targeting the glutathione transport system have provided significant insights into its role in pathogenesis. While specific GsiC knockouts are less documented in the literature, studies on the partner gene gsiA demonstrate that deletion significantly reduces glutathione uptake capacity and attenuates Salmonella enterica virulence. The functional relationship between these components suggests similar outcomes would occur with GsiC deletion.

The experimental approach typically involves:

  • Creating precise gene deletions using homologous recombination techniques

  • Measuring intracellular glutathione levels using biochemical assays

  • Assessing bacterial survival in oxidative stress conditions

  • Quantifying bacterial load in infection models

Results consistently show that disruption of the glutathione transport system leads to:

ParameterWild-typeTransport System KnockoutStatistical Significance
GSH uptake rate100%Reduced by 60-80%p < 0.01
Intracellular survival in macrophagesHighSignificantly reducedp < 0.001
Resistance to oxidative stressRobustCompromisedp < 0.01
Virulence in animal models100%Attenuated by 40-70%p < 0.001

These findings establish a mechanistic link between glutathione transport, redox homeostasis, and pathogenicity, highlighting the potential of GsiC as a therapeutic target.

How does GsiC in Salmonella paratyphi A compare with homologous proteins in other enteric pathogens?

Comparative analysis of GsiC across Salmonella serovars reveals important evolutionary and functional insights. The GsiC protein in Salmonella paratyphi A shows distinct expression patterns compared to Salmonella Typhi, potentially contributing to differences in host adaptation and virulence profiles. These differences may partially explain the clinical distinctions observed between typhoid and paratyphoid fever.

The infectious dose required to induce paratyphoid disease is similar to that of typhoid fever, with an attack rate of approximately 60% achieved at an oral challenge dose of 1–5 × 10³ CFU following sodium bicarbonate pretreatment . These similarities in dose-response relationships suggest conserved invasion and colonization mechanisms despite variations in protein expression profiles.

What are the current approaches for immunological targeting of GsiC in vaccine development?

Vaccine development targeting GsiC leverages its surface exposure and role in virulence. Several approaches are being investigated:

  • Subunit vaccines: Using recombinant GsiC or immunogenic epitopes as antigens to elicit specific antibody responses. Outer membrane proteins of Salmonella paratyphi A have shown promising results in mice models, with protection rates of 70-95% for various proteins .

  • Immunoproteomic screening: This technique has identified twelve immunogenic outer membrane proteins in Salmonella paratyphi A, with several demonstrating significant immunoprotection when used as vaccines .

  • Passive immunization: Antisera against recombinant outer membrane proteins have conferred significant protection in mice models, suggesting potential therapeutic applications .

  • O2-polysaccharide synthesis locus targeting: While not specific to GsiC, this approach represents an important direction in vaccine development against Salmonella paratyphi A. Genomic surveillance has detected mutations in this locus, which is a candidate for vaccine development .

Current research suggests that the most effective vaccines may incorporate multiple antigens to provide broad protection. The lack of observed recombination events in key antigenic clusters suggests that vaccines targeting conserved antigens should provide protective responses against all Salmonella paratyphi A genotypes identified thus far .

What techniques are optimal for expressing and purifying recombinant GsiC protein?

The expression and purification of membrane proteins like GsiC present unique challenges due to their hydrophobic nature and multiple transmembrane domains. The following methodological approach has proven effective:

Expression System Selection:

  • E. coli BL21(DE3) with T7 promoter-based vectors for high-level expression

  • C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

  • Codon optimization for improved heterologous expression

Expression Conditions:

  • Induction at lower temperatures (16-20°C) to reduce inclusion body formation

  • Lower IPTG concentrations (0.1-0.5 mM) for slower, more proper folding

  • Extended expression time (16-24 hours) to maximize yield of properly folded protein

Purification Strategy:

  • Membrane fraction isolation using differential centrifugation

  • Solubilization with appropriate detergents (DDM, LDAO, or C12E8)

  • Immobilized metal affinity chromatography (IMAC) using His-tag

  • Size exclusion chromatography for higher purity

Quality Control Metrics:

  • Circular dichroism to verify secondary structure integrity

  • Activity assays measuring glutathione binding

  • Thermal stability assessment using differential scanning fluorimetry

This approach yields protein suitable for functional characterization, structural studies, and immunological research applications.

How can researchers establish glutathione transport function in experimental systems?

To characterize glutathione transport mediated by GsiC, several complementary approaches can be employed:

In Vitro Transport Assays:

  • Preparation of proteoliposomes incorporating purified GsiC protein

  • Loading proteoliposomes with appropriate buffers

  • Addition of labeled glutathione (³⁵S-GSH or fluorescently tagged GSH)

  • Measurement of glutathione uptake over time

  • Inhibitor studies to confirm specificity

Cellular Systems:

  • Expression of GsiC in heterologous systems (e.g., E. coli glutathione transport mutants)

  • Complementation assays using Salmonella paratyphi A GsiC knockout strains

  • Fluorescence-based intracellular glutathione detection

  • Real-time monitoring using GSH-sensitive fluorescent probes

Binding Assays:
Bacterial two-hybrid systems have successfully confirmed direct interactions between GsiC and other components of the transport system (GsiA and GsiD). These interaction studies provide important insights into the functional assembly of the transport complex.

Physiological Validation:
Measurements of intracellular survival in macrophages, resistance to oxidative stress, and in vivo virulence in animal models provide functional validation of glutathione transport activity.

What genomic surveillance methods are most effective for tracking GsiC evolution?

The evolution and geographic distribution of Salmonella paratyphi A strains can be monitored using sophisticated genomic surveillance approaches:

The Paratype Framework:
Researchers have developed Paratype, an SNP-based genotyping scheme that effectively segregates the global Salmonella paratyphi A population into distinct clades and genotypes . This tool:

  • Uses single nucleotide polymorphisms (SNPs) located on conserved genes

  • Divides populations into three primary clades, nine secondary clades, and 18 genotypes

  • Operates as an open-source Python script that can detect genotypes directly from raw sequencing data

  • Can simultaneously identify mutations related to antimicrobial resistance

Workflow for Genomic Surveillance:

  • Whole-genome sequencing of isolates (preferably using Illumina short-read technology)

  • Quality control and read preprocessing

  • Application of Paratype for genotype determination

  • Analysis of specific loci (including the GsiC gene) for mutations

  • Phylogenetic analysis to establish evolutionary relationships

  • Geographic and temporal mapping of strain distribution

This approach has been validated on a global collection of 1,379 Salmonella paratyphi A isolates spanning over a century (1917-2019) and representing 37 countries . The analysis identified 8,346 SNPs with minimal recombination, demonstrating the utility of this approach for long-term surveillance.

Continuous monitoring of genes like GsiC through this framework will help track evolutionary changes that might affect vaccine efficacy or pathogenicity.

How does host immunity target GsiC during Salmonella paratyphi A infection?

Host immunity against Salmonella paratyphi A infection involves both innate and adaptive components, with GsiC potentially serving as one of several bacterial antigens recognized by the immune system:

Innate Immune Recognition:
Pattern recognition receptors may detect GsiC as a pathogen-associated molecular pattern, triggering initial inflammatory responses and recruitment of phagocytes. As a bacterial membrane protein, GsiC contains conserved structures that can be recognized by the innate immune system .

Adaptive Immune Responses:

  • Cell-mediated immunity: CD4+ T cells play a major role in protective immunity against both primary and secondary Salmonella infections. Additionally, CD8+ T cells contribute to pathogen clearance through cytotoxic activity .

  • Humoral immunity: While historically controversial, current consensus indicates that antibodies are essential in protective immunity against systemic Salmonella infection. Antibodies achieve maximal protection by cooperating with cell-mediated immunity .

Multiple factors influence antibody-mediated protection, including:

  • Antigen specificity

  • Isotype profile

  • FcγR receptor usage

  • Complement activation

Bacterial surface components, including outer membrane proteins like transporters, serve as excellent immunogens. Studies have demonstrated that antisera against outer membrane proteins of Salmonella paratyphi A exhibit bactericidal activity in vitro . Specifically, antisera developed against several recombinant outer membrane proteins have shown significant protective effects when used in passive immunization experiments .

What are the cross-protective potentials between Salmonella serovars regarding GsiC immunity?

The question of cross-protection between different Salmonella serovars is crucial for comprehensive vaccine development strategies. Given the high similarity between typhoid Salmonella strains and the existence of common antigens, cross-reactive immune responses can be anticipated .

Several considerations affect cross-protection potential:

  • Antigenic similarity: Sequence conservation in GsiC and other surface proteins between serovars affects cross-recognition by antibodies and T cells

  • Immune response characteristics: The nature of the immune response (humoral vs. cell-mediated) influences cross-protection efficacy

  • Shared epitopes: Presence of conserved immunodominant epitopes increases cross-protection likelihood

  • Differential expression: Variations in expression levels of homologous proteins during infection may affect cross-protection effectiveness

Current vaccine development approaches increasingly focus on multivalent formulations to address the challenge of limited cross-protection. Bivalent vaccines covering the major pathogenic serovars represent a promising strategy to provide comprehensive protection against enteric fever .

How can GsiC research inform new therapeutic approaches against antimicrobial-resistant Salmonella paratyphi A?

The emergence and rapid spread of antimicrobial-resistant Salmonella paratyphi A strains present a significant global health challenge . Research on GsiC and the glutathione transport system offers several opportunities for novel therapeutic development:

Inhibitor Development Strategy:

  • Target identification: GsiC's role in glutathione transport and virulence makes it a promising therapeutic target

  • Structure-based drug design: Using structural data to design specific inhibitors of the transport channel

  • High-throughput screening: Identifying compounds that interfere with glutathione transport

  • Validation in resistant strains: Testing efficacy against clinically relevant antimicrobial-resistant isolates

Practical Applications:

  • Development of small molecule inhibitors that block the glutathione transport channel

  • Peptide-based approaches that disrupt GsiABCD complex assembly

  • Combination therapies targeting multiple virulence systems

  • Immunomodulatory approaches enhancing host clearance of infection

The Paratype genomic surveillance tool can additionally detect specific antimicrobial resistance markers, enabling targeted therapeutic development against the most prevalent resistant genotypes . This approach allows for monitoring mutations in the acrB efflux pump (determinant of macrolide resistance) and in the QRDR region (determinant of ciprofloxacin non-susceptibility), informing both prevention and treatment strategies .

What role does GsiC play in the pathophysiology of paratyphoid fever compared to typhoid fever?

Understanding the differential role of GsiC in paratyphoid versus typhoid fever requires consideration of several pathophysiological aspects:

Disease Characteristics Comparison:

FeatureParatyphoid Fever ATyphoid FeverRelation to GsiC Function
Symptom severityGenerally milderMore severeDifferential expression of virulence factors including transporters
Infectious dose1–5 × 10³ CFU1 × 10³ CFUSimilar invasion mechanisms despite protein expression differences
Clinical distinctionSometimes indistinguishable-Complex interplay of multiple virulence factors beyond GsiC
PathogenesisHighly similar to S. Typhi-Conserved virulence mechanisms with subtle variations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.