Recombinant Salmonella paratyphi A Glutathione transport system permease protein gsiD (gsiD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
gsiD; SPA1904; Glutathione transport system permease protein GsiD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
gsiD
Target Protein Sequence
MRLFNWRRQAILHAMPVVKPDQIRTPWREFWRRFRRQHVALVAGGFVLALILVAIFARWL TPYDAENYFDYDSLNNGPSLQHWFGVDSLGRDIFSRVLVGAQISLAAGVFAVFIGAIIGT VLGLLAGYYEGWWDRFIMRICDVLFAFPGILLAIAVVAVLGSGIANVIVAVAIFSIPAFA RLVRGNTLVLKQQTFIESARSIGASDTTILFSHILPGTVSSIVVFFTMRIGTSIISAASL SFLGLGAQPPTPEWGAMLNEARADMVIAPHVALFPAVAIFLTVLAFNLLGDGLRDALDPK IKG
Uniprot No.

Target Background

Function
GsiD is a component of the ABC transporter complex GsiABCD in *Salmonella paratyphi A*, responsible for glutathione import. Its primary function is likely the transmembrane translocation of the substrate.
Database Links

KEGG: spt:SPA1904

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Glutathione Transport System Permease Protein GsiD in Salmonella paratyphi A?

The glutathione transport system permease protein GsiD (also referred to as gsiD) is a membrane protein component of the glutathione transport system in Salmonella paratyphi A. It functions as a permease protein facilitating the transport of glutathione across the bacterial cell membrane. The full-length protein consists of 303 amino acids and plays a crucial role in the bacterium's ability to import glutathione, which contributes to various cellular processes including oxidative stress response and metabolic functions . The protein structure includes multiple transmembrane domains typical of bacterial permease proteins involved in substrate transport across membranes.

How does GsiD relate to the pathogenesis of Salmonella paratyphi A?

Salmonella paratyphi A is one of the causative agents of enteric fever, with increasing incidence worldwide . While the direct relationship between GsiD and pathogenesis is not fully characterized in the provided literature, transport systems are generally critical for bacterial survival and virulence. Glutathione transport may contribute to Salmonella paratyphi A's ability to survive within host cells by providing protection against oxidative stress generated by host immune responses. The bacterium typically invades intestinal epithelial cells, particularly M cells overlying Peyer's patches, then disseminates through lymphatic vessels to the bloodstream and various organs including the spleen, liver, and bone marrow . Transport proteins like GsiD likely play supporting roles in bacterial survival during this infection process.

How is recombinant GsiD protein typically produced for research purposes?

Recombinant Salmonella paratyphi A GsiD protein is typically produced using heterologous expression systems, with E. coli being the most common host. For research applications, the full-length protein (1-303 amino acids) is often expressed with affinity tags, such as histidine tags, to facilitate purification . The production process generally involves:

  • Cloning the gsiD gene (using the Q5PGP6 reference sequence) into an expression vector

  • Transformation of the construct into E. coli expression strains

  • Induction of protein expression (commonly using IPTG for T7-based systems)

  • Cell lysis and protein extraction

  • Affinity purification using the His-tag

  • Quality control testing including SDS-PAGE and Western blotting to confirm identity and integrity

What are the recommended protocols for functional characterization of recombinant GsiD?

Functional characterization of recombinant GsiD requires multiple approaches to assess its transport capabilities and biochemical properties:

Transport Assays:

  • Liposome Reconstitution Assay: Purified GsiD can be reconstituted into liposomes to measure glutathione transport rates.

  • Whole Cell Transport Assays: Using radiolabeled glutathione or fluorescent glutathione analogs to measure uptake in cells expressing GsiD versus control cells.

Binding Studies:

  • Isothermal Titration Calorimetry (ITC): To determine binding constants for glutathione and potential inhibitors.

  • Surface Plasmon Resonance (SPR): For real-time binding kinetics measurements.

Structural Analysis:

  • Circular Dichroism (CD): To evaluate secondary structure elements.

  • Limited Proteolysis: To identify flexible regions and domain organization.

These methods should be optimized considering the membrane protein nature of GsiD, which often presents technical challenges due to hydrophobicity and potential instability when removed from the membrane environment.

How can researchers effectively use recombinant GsiD protein in vaccine development studies?

While current vaccines for enteric fever are predominantly developed from S. Typhi and lack adequate cross-protection against S. Paratyphi A , researchers can explore GsiD's potential as a vaccine candidate using the following methodological approach:

  • Epitope Mapping: Identify immunogenic regions of GsiD using computational prediction and experimental validation with synthetic peptides.

  • Immunogenicity Testing: Evaluate antibody responses in animal models using purified recombinant GsiD. Monitor both humoral and cell-mediated immune responses.

  • Challenge Studies: Assess protective efficacy following immunization in appropriate animal models.

  • Adjuvant Selection: Test various adjuvants to enhance immunogenicity of GsiD-based formulations.

  • Combination Approaches: Consider combining GsiD with other Salmonella antigens for broader protection, especially given the limited cross-protection between S. Typhi and S. Paratyphi A vaccines .

Experimental Considerations:

  • Use both whole protein and selected epitope approaches

  • Compare different delivery systems (including attenuated strains, subunit vaccines, and vesicle vaccines)

  • Evaluate cross-protection against different strains of S. Paratyphi A

Given that paratyphoid A vaccines are urgently needed due to increasing infection rates and antimicrobial resistance , GsiD represents a potential target for exploration in vaccine development strategies.

What techniques are most effective for studying GsiD interactions with host cells during infection?

To study GsiD's role during host-pathogen interactions, researchers can employ several methodological approaches:

Cell Infection Models:

  • Organoid Models: Human gallbladder organoids provide an excellent system for studying S. Paratyphi A infection, as demonstrated for other virulence factors . These can be adapted to study GsiD's role by comparing wild-type and gsiD knockout strains.

  • Polarized Epithelial Monolayers: Air-liquid interphase cultures allow extended infection periods and more physiologically relevant conditions .

  • Fluorescent Tagging: Using fluorescently tagged GsiD to track its localization during infection.

Interaction Analysis:

  • Co-immunoprecipitation: To identify host proteins that interact with GsiD.

  • Proximity Labeling: BioID or APEX2 fusions to GsiD to identify proximal proteins in the host cell environment.

  • Yeast Two-Hybrid Screening: To screen for potential host protein interactors.

Functional Assessment:

  • Knockout/Complementation Studies: Compare infection outcomes between wild-type, ΔgsiD mutant, and complemented strains.

  • Site-directed Mutagenesis: Target specific functional domains to identify residues critical for pathogenesis.

These approaches should be interpreted with careful controls to distinguish GsiD-specific effects from general Salmonella pathogenesis mechanisms.

How does the genetic variation in gsiD across different Salmonella Paratyphi A genotypes influence protein function and pathogenesis?

Recent genotyping studies have revealed significant genomic variation in the global Salmonella Paratyphi A population, with three primary clades, nine secondary clades, and 18 distinct genotypes identified through SNP-based analysis . While specific variations in the gsiD gene were not directly described in the search results, researchers investigating this question should:

  • Perform Comparative Genomic Analysis:

    • Extract gsiD sequences from representative isolates of each genotype

    • Analyze nucleotide and amino acid variations

    • Identify non-synonymous mutations that may affect protein function

  • Structure-Function Correlation:

    • Model the impact of identified variations on protein structure

    • Assess conservation of key functional domains across genotypes

  • Experimental Validation:

    • Express variant forms of GsiD corresponding to different genotypes

    • Compare transport efficiency and substrate specificity

    • Evaluate contribution to virulence in infection models

Analysis LevelMethodsExpected Outcomes
Sequence AnalysisMultiple sequence alignment, SNP identificationIdentification of conserved and variable regions
Structural PredictionHomology modeling, molecular dynamics simulationPrediction of functional impact of variants
Functional AssessmentTransport assays with variant proteinsQuantification of functional differences
Virulence CorrelationInfection studies with isogenic strainsDetermination of pathogenic significance

Understanding these variations may provide insights into the evolution of S. Paratyphi A and potentially inform strategies for diagnostic test development and therapeutic interventions.

What is the role of GsiD in antimicrobial resistance mechanisms of Salmonella Paratyphi A?

  • Transcriptomic Analysis:

    • Compare gsiD expression levels between sensitive and resistant isolates

    • Assess expression changes in response to antibiotic exposure

  • Gene Knockout Studies:

    • Generate ΔgsiD mutants in various genetic backgrounds

    • Determine changes in minimum inhibitory concentrations (MICs) for different antibiotics

    • Assess complementation with wild-type and variant gsiD alleles

  • Efflux Pump Activity:

    • Investigate potential interactions between GsiD and known efflux systems

    • Measure antibiotic accumulation in cells with varying GsiD expression levels

  • Glutathione Homeostasis and Resistance:

    • Examine the relationship between glutathione transport, oxidative stress responses, and antibiotic tolerance

    • Test whether glutathione supplementation affects resistance profiles in wild-type versus ΔgsiD strains

This research is particularly important given that fluoroquinolone-resistant Salmonellae have been ranked as high-priority pathogens for new antibiotic development , and understanding the potential involvement of transport systems like GsiD could reveal new therapeutic targets.

How does the GsiD protein interact with the typhoid toxin system in Salmonella Paratyphi A?

Salmonella Paratyphi A produces typhoid toxin, which includes the CdtB subunit that causes DNA damage in host cells and contributes to genomic instability . While direct interactions between GsiD and the typhoid toxin system are not explicitly described in the provided literature, researchers can investigate potential functional relationships through:

  • Co-expression Analysis:

    • Determine if gsiD and typhoid toxin genes are co-regulated under infection-relevant conditions

    • Identify common transcriptional regulators

  • Protein-Protein Interaction Studies:

    • Perform co-immunoprecipitation experiments to detect physical interactions

    • Use bacterial two-hybrid or split-protein complementation assays to test direct interactions

  • Mutant Phenotype Analysis:

    • Compare the infection phenotypes of ΔgsiD, ΔcdtB, and double mutants

    • Assess host cell DNA damage, cell cycle effects, and intracellular survival

  • Transport Studies:

    • Investigate whether GsiD-mediated glutathione transport affects typhoid toxin production, secretion, or activity

    • Test if glutathione levels modulate toxin-induced DNA damage

This research direction is particularly intriguing given the importance of the typhoid toxin in driving host genomic instability and its potential role in carcinogenesis, especially in gallbladder cancer associated with chronic Salmonella infection .

What methodological approaches can overcome the challenges in studying membrane proteins like GsiD?

Membrane proteins like GsiD present significant technical challenges for structural and functional studies. Researchers should consider these advanced methodological approaches:

  • Expression System Optimization:

    • Test multiple expression hosts beyond E. coli, including Pichia pastoris and mammalian cell lines

    • Utilize specialized E. coli strains designed for membrane protein expression

    • Optimize growth conditions (temperature, induction parameters, media composition)

  • Protein Stabilization Strategies:

    • Screen detergents and lipid compositions for optimal stability

    • Consider nanodiscs, amphipols, or styrene-maleic acid copolymer lipid particles (SMALPs) as alternatives to detergent solubilization

    • Employ fusion partners that enhance stability and crystallization properties

  • Structural Determination Approaches:

    • Cryo-electron microscopy (cryo-EM) for detergent-solubilized or nanodisc-reconstituted GsiD

    • X-ray crystallography with stabilizing antibody fragments or nanobodies

    • Solid-state NMR for studying dynamic aspects of transport function

  • Functional Characterization in Native-like Environments:

    • Proteoliposome-based transport assays with defined lipid compositions

    • Single-molecule techniques to monitor conformational changes during transport cycle

    • In-cell assays using genetic sensors for glutathione transport

These methodological innovations can help overcome the intrinsic difficulties of working with membrane transport proteins and provide more physiologically relevant insights into GsiD function.

How might the characterization of GsiD contribute to understanding the increasing prevalence of Salmonella Paratyphi A infections globally?

The global burden of Salmonella Paratyphi A infections has been increasing in recent decades , with important implications for public health. Detailed characterization of GsiD could contribute to understanding this trend through:

  • Evolutionary Analysis:

    • Track changes in gsiD sequences across historical isolates

    • Correlate genetic changes with emergence of successful lineages

    • Identify potential adaptive mutations that enhance fitness or transmission

  • Host Adaptation Studies:

    • Examine how GsiD variants might contribute to host-specific adaptation

    • Investigate potential roles in environmental persistence outside human hosts

  • Transmission Dynamics:

    • Develop GsiD-based typing methods to complement existing genotyping approaches like Paratype

    • Track specific variants through outbreak investigations

  • Pathogenicity Mechanisms:

    • Determine if changes in glutathione transport efficiency correlate with virulence phenotypes

    • Investigate host-specific glutathione utilization patterns

Understanding the molecular basis of S. Paratyphi A's increasing prevalence is critical for developing effective control strategies, especially given the limited cross-protection offered by current typhoid vaccines and the urgent need for paratyphoid A-specific vaccines.

What integrated approaches can best identify the role of GsiD in Salmonella Paratyphi A vaccine development strategies?

Given the urgent need for paratyphoid A vaccines and the inadequate cross-protection provided by existing typhoid vaccines , researchers should consider these integrated approaches to evaluate GsiD's potential in vaccine development:

  • Reverse Vaccinology Pipeline:

    • Computational epitope prediction combined with experimental validation

    • Assessment of conservation across clinical isolates to ensure broad coverage

    • Evaluation of potential cross-reactivity with human proteins

  • Multi-antigen Formulation Strategy:

    • Test GsiD in combination with other immunogenic S. Paratyphi A antigens

    • Evaluate potential for inclusion in bivalent vaccines targeting both S. Typhi and S. Paratyphi A

    • Compare whole protein versus epitope-based approaches

  • Delivery Platform Evaluation:

    • Test multiple platforms including:

      • Protein subunit vaccines with appropriate adjuvants

      • Live attenuated vectors expressing GsiD

      • Outer membrane vesicle-based delivery systems

      • DNA or mRNA vaccine constructs

  • Immunity Assessment Framework:

    • Comprehensive analysis of both humoral and cell-mediated responses

    • Tissue-specific immune responses, particularly in intestinal mucosa

    • Long-term memory formation and persistence of protection

  • Challenge Models:

    • Utilize recently developed human challenge models to assess protection

    • Develop improved animal models that better recapitulate human disease

These integrated approaches acknowledge the complexity of vaccine development and the need for multifaceted evaluation strategies to develop effective paratyphoid vaccines, particularly given the increasing antimicrobial resistance observed in S. Paratyphi A strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.