Recombinant Salmonella paratyphi A Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Applications in Vaccine Development and Research

PlsY has been utilized in two primary research contexts:

Antigen Characterization

  • Recombinant PlsY serves as a target for antibody production in vaccine studies against Salmonella infections .

  • In S. paratyphi A, PlsY expression remains stable during intracellular infection phases, making it a potential candidate for multi-stage vaccines .

Enzymatic Function Studies

Table 2: Key Functional Insights

Study FocusFindingsSource
Catalytic MechanismTransfers acyl groups from acylphosphate to glycerol-3-phosphate
InhibitionNoncompetitive inhibition by palmitoyl-CoA (IC₅₀ = 12 μM)
Intracellular BehaviorMaintains activity in acidic phagosomal environments during infection

Comparative Analysis With Homologs

PlsY shares functional similarities with:

  • S. typhimurium PlsY: 89% sequence identity but differs in regulation during intracellular replication

  • Streptococcus pneumoniae PlsY: Conserved catalytic motifs but distinct membrane topology

Research Limitations and Future Directions

While recombinant PlsY is commercially available for immunological studies , critical gaps remain:

  • No direct evidence yet links PlsY to Salmonella virulence in human trials

  • Structural data for S. paratyphi A PlsY-ligand complexes are lacking

Current efforts focus on incorporating PlsY into multivalent glycoconjugate vaccines, building on success with O-antigen conjugates .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
plsY; ygiH; SSPA2871; Glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
plsY
Target Protein Sequence
MSAIAPGMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGATNVLRIGGKGAAVAVLI FDILKGMLPVWGAYALGVTPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKLKKKRQKD
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-ACP to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme can also utilize acyl-CoA as a fatty acyl donor, but not acyl-PO(4).
Database Links

KEGG: sek:SSPA2871

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Glycerol-3-phosphate acyltransferase (plsY) in Salmonella paratyphi A?

Glycerol-3-phosphate acyltransferase (plsY) plays a critical role in bacterial membrane phospholipid biosynthesis. Specifically, plsY catalyzes the transfer of acyl groups from acylphosphate to glycerol 3-phosphate, a key step in phosphatidic acid formation, which serves as the foundation for membrane phospholipid synthesis. This pathway represents the most widely distributed mechanism for initiating membrane lipid biosynthesis in bacteria. In Salmonella paratyphi A, as in other bacteria, plsY works in conjunction with PlsX, which converts acyl-acyl carrier protein to acylphosphate, the substrate for plsY .

How do the conserved motifs in plsY contribute to its enzymatic function?

PlsY contains three highly conserved motifs in its cytoplasmic domains, each with distinct functional roles:

MotifKey ResiduesFunctionEffect of Mutation
Motif 1Serine, ArginineEssential for catalysisLoss of enzymatic activity
Motif 2Conserved GlycinesGlycerol 3-phosphate binding site (phosphate-binding loop)Km defect for glycerol 3-phosphate binding
Motif 3Histidine, Asparagine, GlutamateHistidine and Asparagine important for activity; Glutamate critical for structural integrityReduced activity and/or structural destabilization

Site-directed mutagenesis studies have demonstrated that alterations in any of these conserved domains significantly impact plsY catalysis. For example, mutations of the conserved glycines in motif 2 to alanines result in decreased binding affinity for glycerol 3-phosphate, confirming this motif's role as the glycerol 3-phosphate binding site .

What expression systems are most effective for recombinant S. paratyphi A plsY?

The most effective expression system for recombinant S. paratyphi A plsY is E. coli. Due to plsY being an integral membrane protein with multiple transmembrane segments, expression systems must be capable of properly inserting the protein into membranes while maintaining its structural integrity. E. coli expression systems using vectors that incorporate N-terminal His-tags have proven successful for plsY expression. The His-tag facilitates subsequent purification while generally not interfering with the protein's functional properties.

Key considerations for optimal expression include:

  • Using appropriate E. coli strains optimized for membrane protein expression

  • Controlling induction conditions (temperature, inducer concentration, duration)

  • Incorporating fusion tags that enhance solubility while preserving activity

  • Employing growth media and conditions that support membrane protein folding

When expressing recombinant plsY, researchers should monitor for potential toxicity issues that may arise from overexpression of membrane proteins, which can compromise membrane integrity in the host organism .

What purification protocols yield the highest purity and activity of S. paratyphi A plsY?

A multi-step purification protocol typically yields the highest purity and activity for recombinant His-tagged S. paratyphi A plsY:

  • Membrane Fraction Isolation:

    • Lyse cells by sonication or French press in appropriate buffer

    • Separate membrane fraction by ultracentrifugation (100,000×g, 1 hour)

    • Solubilize membrane proteins with detergent (e.g., n-dodecyl-β-D-maltoside)

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Load solubilized membrane fraction onto Ni-NTA or TALON resin

    • Wash with increasing imidazole concentrations to remove non-specific binding

    • Elute His-tagged plsY with high imidazole buffer

  • Size Exclusion Chromatography:

    • Further purify by gel filtration to separate monomeric from aggregated protein

    • Buffer should contain appropriate detergent at concentrations above CMC

  • Quality Control:

    • Assess purity by SDS-PAGE (>90% purity is typically achievable)

    • Confirm identity by Western blotting or mass spectrometry

    • Evaluate activity using enzymatic assays

For storage, the purified protein should be maintained in a buffer containing 6% trehalose at pH 8.0, with 50% glycerol for long-term storage at -20°C/-80°C. Avoid repeated freeze-thaw cycles as these can significantly decrease enzymatic activity .

How can the enzymatic activity of purified recombinant plsY be measured?

The enzymatic activity of purified recombinant plsY can be measured through several complementary assays:

  • Acylphosphate Consumption Assay:

    • Monitor the decrease in acylphosphate concentration over time

    • Use colorimetric detection of released inorganic phosphate

    • Quantify using a standard curve of known phosphate concentrations

  • Lysophosphatidic Acid (LPA) Formation Assay:

    • Incubate plsY with acylphosphate and radiolabeled glycerol-3-phosphate

    • Extract lipids using chloroform/methanol

    • Separate products by thin-layer chromatography

    • Quantify LPA formation through scintillation counting

  • Coupled Enzymatic Assay:

    • Link plsY activity to a secondary reaction that produces a detectable product

    • Monitor the reaction spectrophotometrically in real-time

  • HPLC-Based Analysis:

    • Separate reaction products using reverse-phase HPLC

    • Quantify LPA production using appropriate standards

Kinetic parameters (Km, Vmax) can be determined by varying substrate concentrations and analyzing the data using Michaelis-Menten kinetics. When performing these assays, it's important to include controls for non-enzymatic acylphosphate hydrolysis and to ensure that detergent concentrations are optimized to maintain enzyme activity while not interfering with the assay .

How does plsY contribute to the pathogenesis of S. paratyphi A?

PlsY contributes to S. paratyphi A pathogenesis through several mechanisms:

  • Membrane Biogenesis: As a critical enzyme in phospholipid biosynthesis, plsY is essential for membrane formation, which directly impacts bacterial viability, growth, and division during infection.

  • Host-Pathogen Interface: The bacterial membrane, whose composition is influenced by plsY activity, mediates interactions with host cells and immune components, affecting adhesion, invasion, and immune evasion.

  • Metabolic Adaptation: During infection, S. paratyphi A produces distinct metabolite profiles, many derived from membrane components, that contribute to its survival in the host environment. PlsY activity influences these metabolic signatures that distinguish S. paratyphi A from related pathogens such as S. Typhi .

  • Potential Virulence Regulation: Membrane composition affects the function of embedded virulence factors, secretion systems, and signaling proteins that mediate pathogenesis, indirectly linking plsY function to virulence expression.

Understanding plsY's role in pathogenesis provides insights into fundamental aspects of S. paratyphi A biology and may reveal new approaches for diagnostic or therapeutic interventions against enteric fever .

How can recombinant plsY be used to screen for potential inhibitors?

Recombinant plsY provides an excellent platform for screening potential inhibitors through several approaches:

  • High-Throughput Enzymatic Assays:

    • Adapt activity assays to microplate format

    • Screen compound libraries for inhibition of plsY activity

    • Determine IC50 values for promising candidates

    • Secondary screens to confirm specificity and mechanism

  • Structure-Based Virtual Screening:

    • Use homology models or crystal structures of plsY

    • Perform in silico docking of compound libraries

    • Identify compounds predicted to bind active sites or allosteric regions

    • Validate computational hits with enzymatic assays

  • Fragment-Based Approaches:

    • Screen small molecular fragments for binding to plsY

    • Use thermal shift assays, NMR, or SPR to detect binding

    • Develop fragments into more potent inhibitors

  • Competitive Binding Assays:

    • Develop assays measuring displacement of substrate analogs

    • Focus on compounds that compete with acylphosphate or glycerol-3-phosphate

When designing screening campaigns, researchers should consider the known non-competitive inhibition by palmitoyl-CoA as a mechanistic model. Additionally, the conserved motifs identified as essential for catalysis (particularly motifs 1 and 2) represent prime targets for inhibitor design .

What role might plsY play in developing new antimicrobials against S. paratyphi A?

PlsY represents a promising target for novel antimicrobials against S. paratyphi A for several reasons:

  • Essential Function: PlsY catalyzes a critical step in membrane phospholipid biosynthesis, making it essential for bacterial viability and growth.

  • Pathway Uniqueness: The PlsX/PlsY pathway represents the most widely distributed mechanism for phosphatidic acid formation in bacteria but differs from eukaryotic pathways, offering potential selectivity.

  • Structural Knowledge: Understanding of the key catalytic motifs and active site structure enables rational design of inhibitors targeting specific functional domains.

  • Resistance Considerations: Since S. paratyphi A strains increasingly show resistance to conventional antibiotics (as evidenced in the Vadodara outbreak analysis), targeting essential enzymes like plsY that have not been subject to selection pressure offers advantages .

Development strategies could include:

  • Structure-based design of small molecules targeting the conserved motifs

  • Peptide inhibitors mimicking substrate binding regions

  • Covalent inhibitors targeting essential catalytic residues

  • Allosteric inhibitors disrupting protein conformational changes

Given the emergence of antimicrobial resistance in S. paratyphi A, including mutations conferring reduced quinolone susceptibility, new molecular targets like plsY are increasingly important for future therapeutic development .

How do plsY homologs differ across bacterial species and what are the implications for broad-spectrum inhibitor design?

Comparative analysis of plsY homologs across bacterial species reveals important considerations for broad-spectrum inhibitor design:

When designing inhibitors, researchers should consider that while the catalytic mechanism is conserved, differences in substrate preference and regulatory mechanisms exist across species. Computational approaches like sequence alignment, homology modeling, and molecular dynamics simulations can identify both conserved targets for broad-spectrum activity and variable regions for selectivity .

What computational approaches can predict functional changes in plsY variants?

Several computational approaches can effectively predict functional changes in plsY variants:

  • Machine Learning Algorithms:
    Advanced algorithms like CLEAN (Contrastive Learning-Enabled Enzyme Annotation) can predict enzyme function based on sequence information. CLEAN has demonstrated superior accuracy over traditional methods like BLASTp in assigning Enzyme Commission (EC) numbers to enzymes, including those with previously uncharacterized functions or multiple activities. This approach could be applied to predict the functional impact of plsY variants4.

  • Molecular Dynamics Simulations:

    • Simulate the behavior of wild-type and variant plsY in membrane environments

    • Analyze changes in protein flexibility, substrate binding, and catalytic residue positioning

    • Predict effects on enzyme kinetics and stability

  • Quantum Mechanics/Molecular Mechanics (QM/MM):

    • Model the reaction mechanism at atomic level

    • Predict how mutations affect transition states and energy barriers

    • Estimate changes in catalytic efficiency

  • Evolutionary Coupling Analysis:

    • Identify co-evolving residues that maintain function

    • Predict compensatory mutations that may restore activity

    • Assess conservation patterns across bacterial species

  • Protein Structure Networks:

    • Analyze how mutations affect the network of interactions within plsY

    • Predict long-range effects of mutations on protein dynamics

    • Identify allosteric communication pathways

These computational approaches can guide experimental design by prioritizing which variants to characterize biochemically and structurally, ultimately accelerating the understanding of structure-function relationships in plsY4.

How might plsY interact with other enzymes in the phospholipid biosynthesis pathway?

PlsY functions within a complex network of enzymes involved in phospholipid biosynthesis, with several potential protein-protein interactions that influence pathway regulation and metabolic flux:

  • PlsX-PlsY Interaction:

    • PlsX generates acylphosphate, the substrate for plsY

    • Evidence suggests potential direct interaction for substrate channeling

    • Coordinated regulation ensures balanced production of intermediates

  • Interaction with Acyl Carrier Protein (ACP):

    • ACP delivers acyl chains to PlsX

    • Transient interactions may occur between plsY and ACP

    • These interactions could influence acyl chain selectivity

  • Downstream Enzyme Interactions:

    • PlsY products serve as substrates for PlsC (1-acylglycerol-3-phosphate acyltransferase)

    • Potential protein complexes may form to facilitate product transfer

    • Membrane localization may facilitate proximity-based interactions

  • Regulatory Protein Interactions:

    • Interactions with regulatory proteins may modulate plsY activity based on cellular needs

    • Phosphorylation or other post-translational modifications could involve kinase interactions

Research techniques to investigate these interactions include:

  • Bacterial two-hybrid systems adapted for membrane proteins

  • Co-immunoprecipitation with crosslinking

  • FRET/BRET analysis of protein proximity in vivo

  • Mass spectrometry-based interactome analysis

  • In situ labeling approaches

Understanding these interactions is crucial for developing a systems-level view of bacterial membrane biogenesis and for identifying potential points of intervention that might disrupt multiple steps in the pathway simultaneously .

How can structural biology approaches enhance our understanding of plsY function and inhibition?

Structural biology approaches offer powerful insights into plsY function and inhibition potential:

  • X-ray Crystallography:

    • Determine high-resolution structures of plsY in different conformational states

    • Co-crystallize with substrates, products, or inhibitors to map binding sites

    • Challenge: Obtaining well-diffracting crystals of membrane proteins requires specialized techniques including lipidic cubic phase crystallization

  • Cryo-Electron Microscopy:

    • Visualize plsY in native-like membrane environments

    • Capture different conformational states during catalysis

    • Advantage: Does not require crystallization, better for conformational heterogeneity

  • Nuclear Magnetic Resonance (NMR):

    • Analyze dynamics of specific regions during catalysis

    • Study ligand binding through chemical shift perturbations

    • Application: Particularly useful for studying flexible regions not well-resolved in static structures

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map conformational changes upon substrate or inhibitor binding

    • Identify regions with altered solvent accessibility during catalysis

    • Advantage: Can work with relatively small amounts of protein

  • Single-Molecule FRET:

    • Track conformational changes in real-time

    • Measure kinetics of individual steps in the catalytic cycle

    • Benefit: Reveals heterogeneity masked in ensemble measurements

These approaches can answer key questions about plsY:

  • How does substrate binding trigger conformational changes?

  • What is the precise architecture of the active site?

  • How do the membrane-spanning regions contribute to function?

  • What conformational changes accompany catalysis?

The structural information gained can guide rational drug design by identifying binding pockets, allosteric sites, and conformational states amenable to inhibition .

How can research on S. paratyphi A plsY contribute to improved diagnostics for enteric fever?

Research on S. paratyphi A plsY can contribute to improved diagnostics for enteric fever through several avenues:

  • Metabolomic Signature Detection:
    S. paratyphi A produces distinct metabolite profiles during infection, many influenced by membrane phospholipid composition that plsY helps determine. Studies have shown that these profiles can differentiate S. paratyphi A from S. Typhi infections, potentially enabling more specific diagnoses. Gas chromatography with time-of-flight mass spectrometry (GCxGC/TOFMS) has been used to identify 695 individual metabolite peaks in plasma from infected patients, with highly significant and reproducible metabolite profiles that can identify the specific pathogen .

  • Enzyme-Based Biomarkers:

    • Detect plsY-specific products in patient samples

    • Measure alterations in phospholipid composition in host cells

    • Identify plsY-dependent modifications to host metabolites

  • Immunodiagnostic Approaches:
    Similar to how monoclonal antibodies against S. paratyphi A flagellin have been developed for diagnostic purposes, antibodies specific to unique epitopes of plsY could be developed. Research has shown that species-specific proteins can be effective diagnostic targets, as demonstrated with the 52 kDa flagellin protein .

  • Molecular Detection Methods:

    • PCR-based assays targeting plsY gene variants specific to S. paratyphi A

    • CRISPR-Cas diagnostic systems detecting plsY sequence variations

    • Next-generation sequencing approaches identifying plsY in complex samples

By integrating plsY research with advanced diagnostic platforms, more accurate and rapid identification of S. paratyphi A infections could be achieved, leading to more targeted treatment strategies for enteric fever .

What structural features of plsY make it a promising target for antimicrobial development?

PlsY possesses several structural features that make it particularly promising as an antimicrobial target:

  • Essential Active Site Architecture:
    The three conserved motifs in plsY's cytoplasmic domains form a unique active site architecture essential for catalytic function. Each motif contains residues (serine/arginine in motif 1, glycines in motif 2, histidine/asparagine/glutamate in motif 3) that are critical for activity and represent potential binding sites for inhibitory compounds .

  • Membrane-Embedded Nature:
    The five membrane-spanning segments of plsY create a distinctive topology with the active site positioned at the membrane interface. This location allows potential inhibitors to target membrane-accessible regions that differ significantly from host enzymes .

  • Substrate Binding Pockets:
    The glycerol-3-phosphate binding site in motif 2 forms a defined pocket with characteristics of a phosphate-binding loop, offering a structurally conserved target for competitive inhibitors. The acylphosphate binding site provides another potential target with high specificity for bacterial metabolism .

  • Allosteric Regulation Sites:
    PlsY is noncompetitively inhibited by palmitoyl-CoA, indicating the presence of allosteric regulation sites that could be exploited for inhibitor design. These sites may offer advantages for developing inhibitors with novel mechanisms of action .

  • Bacterial Specificity:
    The PlsX/PlsY pathway represents a bacterial-specific route to phosphatidic acid formation that differs fundamentally from the mammalian glycerol-3-phosphate acyltransferase system, offering inherent selectivity for antimicrobial targeting.

These structural features, combined with plsY's essential role in bacterial membrane biogenesis, make it an excellent candidate for structure-based drug design approaches aimed at developing new antimicrobials against increasingly resistant S. paratyphi A strains .

How might enzyme function prediction tools like CLEAN improve plsY research?

Enzyme function prediction tools like CLEAN (Contrastive Learning-Enabled Enzyme Annotation) can significantly advance plsY research in multiple ways:

  • Improved Functional Annotation:
    CLEAN uses contrastive learning, a machine learning approach that outperforms traditional methods like BLASTp in assigning EC numbers to enzymes. For plsY research, this means more accurate identification and functional characterization of plsY homologs across bacterial species, including those with limited experimental characterization4.

  • Detection of Novel Functions:
    CLEAN demonstrates superior capability in annotating understudied enzymes, which could help identify previously unknown secondary functions or activities of plsY variants. This might reveal unexpected roles of plsY in bacterial physiology beyond phospholipid biosynthesis4.

  • Identification of Mislabeled Enzymes:
    The ability of CLEAN to correct mislabeled enzymes could resolve inconsistencies in current plsY annotations across bacterial genomes, ensuring that comparative analyses are based on correctly identified homologs4.

  • Recognition of Enzyme Promiscuity:
    CLEAN can identify promiscuous enzymes with multiple EC numbers. If plsY exhibits substrate promiscuity or moonlighting functions, CLEAN could help identify these additional activities, expanding our understanding of plsY's role in bacterial metabolism4.

  • Predictive Power for Engineering:
    By accurately predicting the functional consequences of sequence variations, CLEAN could guide protein engineering efforts to modify plsY specificity, activity, or inhibitor sensitivity.

Implementation of CLEAN and similar advanced computational tools represents a significant advancement for plsY research, enabling more comprehensive functional characterization that complements traditional biochemical and structural approaches. These tools are particularly valuable for studying the diverse plsY homologs found across bacterial pathogens, potentially revealing new insights relevant to antimicrobial development4.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.