Recombinant Salmonella paratyphi A Hemolysin E (hlyE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hlyE; clyA; sheA; SPA1306; Hemolysin E; Cytotoxin ClyA; Silent hemolysin SheA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-303
Protein Length
Full Length of Mature Protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
hlyE
Target Protein Sequence
TGIFAEQTVEVVKSAIETADGALDFYNKYLDQVIPWKTFDETIKELSRFKQEYSQEASVL VGDIKVLLMDSQDKYFEATQTVYEWCGVVTQLLSAYILLFDEYNEKKASAQKDILIRILD DGVNKLNEAQKSLLGSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDRIRKEAYAGA AAGIVAGPFGLIISYSIAAGVIEGKLIPELNDRLKAVQNFFTSLSVTVKQANKDIDAAKL KLATEIAAIGEIKTETETTRFYVDYDDLMLSLLKGAAKKMINTCNEYQQRHGKKTLLEVP DI
Uniprot No.

Target Background

Function
This toxin exhibits hemolytic activity against mammalian cells by forming pore-like structures upon cellular contact.
Database Links

KEGG: spt:SPA1306

Protein Families
Hemolysin E family
Subcellular Location
Secreted. Periplasm. Host cell membrane; Single-pass membrane protein.

Q&A

What is Hemolysin E (HlyE) and how does it function in Salmonella pathogenesis?

Hemolysin E, encoded by the hlyE gene (also called clyA or sheA), is a pore-forming protein of approximately 34 kDa with hemolytic and cytotoxic activities that plays a crucial role in Salmonella pathogenesis. The protein functions by forming large, stable pores in target membranes upon contact with mammalian cells, resulting in hemolysis of erythrocytes and apoptogenic effects on human and murine monocytes/macrophages . HlyE is an essential virulence factor of Salmonella, Escherichia coli, and other enteric bacteria, specifically required for bacterial survival within host macrophages. This intracellular survival mechanism is critical for establishing persistent infection and evading host immune responses . Unlike other Salmonella enterica serovars such as S. typhimurium, this hemolytic activity is specifically present in S. typhi and S. paratyphi A strains, making it a distinctive virulence factor for typhoid-causing serovars .

What expression systems are most effective for producing recombinant HlyE?

For optimal expression of recombinant Salmonella HlyE, E. coli-based expression systems have proven most effective, particularly when utilizing His-tag purification strategies. The recommended methodology involves cloning the hlyE gene into an expression vector containing a His-tag sequence, followed by transformation into an E. coli expression strain such as BL21(DE3) . Expression should be induced with IPTG at mid-log phase, with optimal induction conditions typically around 0.5-1.0 mM IPTG at 37°C for 4-6 hours. For purification, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective due to the His-tag, followed by size exclusion chromatography to achieve >95% purity . When expressed in this system, recombinant HlyE maintains its native conformation and antigenic properties, making it suitable for both immunological studies and diagnostic applications. Critical quality control points include SDS-PAGE verification of the approximately 34 kDa protein band and Western blot confirmation using anti-His antibodies or HlyE-specific antibodies if available.

How can researchers optimize detection systems for HlyE in clinical samples?

Optimizing detection systems for HlyE in clinical samples requires a multi-faceted approach leveraging recent advances in molecular diagnostics. Based on recent research, aptamer-based detection systems show particular promise, with the highest affinity aptamer (AptHlyE97) demonstrating a Kd value of 83.6 nM and excellent specificity against other bacterial species . For implementing such systems, researchers should:

  • Sample preparation optimization: Pretreat clinical samples (blood, stool) with optimized lysis buffers that preserve HlyE structure while eliminating matrix interference.

  • Detection platform selection: Consider ELONA (Enzyme-Linked Oligonucleotide Assay) methodologies, which have successfully distinguished S. Typhi HlyE from proteins of other bacteria including Salmonella Paratyphi A, Salmonella Paratyphi B, Shigella flexneri, Klebsiella pneumonia and Escherichia coli .

  • Signal amplification strategies: Implement sandwich-type detection formats using complementary aptamer pairs (AptHlyE11, AptHlyE45, and AptHlyE97) targeting different epitopes to improve sensitivity.

  • Limit of detection determination: Establish standard curves using recombinant HlyE protein spiked into negative clinical matrices to determine practical detection limits.

The combination of these approaches can lead to detection systems with nanomolar sensitivity and excellent specificity, making them suitable for implementation in resource-limited settings where typhoid fever is endemic .

What are the critical factors affecting HlyE expression during different phases of Salmonella infection?

The expression of HlyE during Salmonella infection is dynamically regulated by multiple factors that vary throughout the infection cycle. During the initial invasion phase, HlyE expression appears to be tightly regulated, with significant variation between different typhoidal strains . Key regulatory factors include:

  • Environmental sensing systems: Oxygen availability significantly impacts HlyE expression, with microaerobic conditions found within host tissues potentially upregulating expression.

  • Host-derived signals: The host macrophage environment modulates HlyE expression, with evidence that the protein is required for bacterial survival within these cells .

  • Strain-specific regulatory networks: Different Salmonella strains demonstrate variable HlyE expression patterns. The Ty21a vaccine strain, for instance, shows increased HlyE-dependent hemolytic activity in vitro compared to other typhoidal strains .

  • Metabolic state: During persistent infection phases, bacterial metabolic adaptation influences virulence factor expression. Studies investigating persistency in Nramp1r mouse models showed differential gene expression patterns between acute and chronic infection phases .

For researchers investigating HlyE expression, these factors should be carefully controlled in experimental design. Cell culture systems should mimic in vivo conditions through oxygen limitation and macrophage co-culture systems. Reporter gene constructs fused to the hlyE promoter can help monitor expression dynamics under various conditions representing different infection phases.

How does HlyE contribute to immune evasion mechanisms in Salmonella infection?

HlyE contributes to Salmonella's immune evasion strategy through multiple mechanisms that target host immune cell function. As a pore-forming protein, HlyE's primary immune evasion function appears to be its ability to modulate host cell death pathways. HlyE forms pores in target membranes upon contact with mammalian cells, which not only causes hemolysis of erythrocytes but also induces apoptogenic effects specifically on human and murine monocytes/macrophages . This targeted effect on immune cells provides Salmonella with several advantages:

  • Macrophage depletion: By inducing apoptosis in macrophages, Salmonella can reduce the population of phagocytic cells capable of bacterial clearance.

  • Inflammatory response modulation: The controlled cell death of immune cells can alter the inflammatory environment to favor bacterial persistence.

  • Intracellular survival protection: HlyE is required for survival within macrophages, suggesting it may neutralize intracellular antimicrobial mechanisms .

Research methodologies to study these mechanisms should include fluorescence-based pore formation assays, apoptosis detection in immune cells exposed to purified HlyE, and comparative infection studies using wild-type and hlyE-deficient Salmonella strains. Flow cytometry analysis of immune cell populations from infected tissues can further elucidate the impact of HlyE on immune cell dynamics in vivo.

What protocols should researchers follow for the purification of recombinant HlyE?

A robust protocol for recombinant HlyE purification involves the following steps:

  • Expression vector construction: Clone the hlyE gene from S. Paratyphi A genomic DNA into a pET-based expression vector with a C-terminal His-tag.

  • Transformation and expression: Transform the construct into E. coli BL21(DE3) and grow cultures to mid-log phase (OD600 = 0.6) before inducing with 0.5 mM IPTG for 4 hours at 37°C.

  • Cell harvest and lysis: Harvest cells by centrifugation (6,000×g, 15 minutes, 4°C) and resuspend in lysis buffer (50 mM Na-phosphate, 300 mM NaCl, 10 mM imidazole, pH 8.0, supplemented with protease inhibitors). Lyse cells by sonication or pressure homogenization.

  • Immobilized metal affinity chromatography (IMAC): Clear lysate by centrifugation (15,000×g, 30 minutes, 4°C) and apply supernatant to Ni-NTA resin. Wash with buffer containing 20 mM imidazole and elute with buffer containing 250 mM imidazole.

  • Size exclusion chromatography: Further purify by gel filtration using a Superdex 75 column equilibrated with 20 mM Na-carbonate buffer, pH 10.0.

  • Quality control: Verify purity (>95%) by SDS-PAGE and confirm identity by Western blot using anti-His antibodies. Assess hemolytic activity using a standardized erythrocyte lysis assay.

  • Storage: Lyophilize in 20 mM Na-carbonate buffer, pH 10.0, for long-term stability .

This protocol typically yields 5-10 mg of pure protein per liter of bacterial culture, with the purified protein maintaining its structural integrity and biological activity as confirmed by circular dichroism spectroscopy and hemolytic activity assays.

How can researchers effectively design aptamer-based detection systems for HlyE?

Development of aptamer-based detection systems for HlyE requires systematic approach:

  • SELEX methodology: Implement systematic evolution of ligands by exponential enrichment using recombinant HlyE as the target. Start with a random DNA library (typically 1014-1015 unique sequences) and perform 8-12 selection rounds with increasing stringency.

  • Aptamer screening: After selection, clone and sequence at least 50 individual aptamer candidates. Analyze for sequence conservation and structural motifs using bioinformatics tools.

  • Affinity determination: Measure binding affinity of promising candidates using methods such as surface plasmon resonance or microscale thermophoresis. Select aptamers with Kd values in the nanomolar range (the best reported aptamer, AptHlyE97, has an affinity of 83.6 nM) .

  • Specificity testing: Challenge aptamers with proteins from related bacteria including Salmonella Paratyphi A, Salmonella Paratyphi B, Shigella flexneri, and Escherichia coli to confirm specificity.

  • ELONA development: For optimal detection sensitivity, develop an enzyme-linked oligonucleotide assay format:

    • Immobilize aptamers on microtiter plates

    • Incubate with clinical samples

    • Detect bound HlyE using a second biotinylated aptamer targeting a different epitope

    • Visualize using streptavidin-HRP and appropriate substrate

This methodology has demonstrated successful differentiation of S. Typhi HlyE from other bacterial proteins with excellent specificity, making it promising for diagnostic applications in resource-limited settings .

What experimental approaches best evaluate HlyE as a vaccine candidate?

A comprehensive evaluation of HlyE as a vaccine candidate requires a multi-stage experimental approach:

  • Antigen preparation and formulation:

    • Express and purify recombinant HlyE to >95% purity using the IMAC and size exclusion protocol

    • Formulate with appropriate adjuvants (e.g., aluminum hydroxide, MF59, or CpG oligonucleotides)

    • Ensure stability of protein structure through biophysical characterization

  • Immunogenicity assessment:

    • Evaluate humoral responses through ELISA measurement of HlyE-specific antibody titers (IgG, IgA, IgM)

    • Characterize cellular immunity via ELISpot assays for IFN-γ production by T cells

    • Assess functional antibody activity through serum bactericidal assays

  • Protection studies in animal models:

    • Use Nramp1r mice for challenge studies, as they support persistent Salmonella infection

    • Compare vaccine efficacy against both acute infection and chronic carrier state

    • Include bacterial burden assessment in multiple organs (liver, spleen, gallbladder)

  • Immune mechanism investigation:

    • Perform adoptive transfer experiments to determine the relative contribution of antibody versus T cell responses

    • Evaluate T cell response profiles to HlyE using IFN-γ ELISPOT assays, comparing vaccinated and challenged individuals

    • Compare responses between vaccinated and naturally infected subjects to validate relevance

  • Cross-protection analysis:

    • Challenge with both S. Typhi and S. Paratyphi A to assess cross-protection potential

    • Evaluate cross-reactivity of immune responses against HlyE variants from different serovars

Experimental evidence suggests HlyE is immunogenic, as confirmed by increased frequency of IFN-γ producing T cells specific for HlyE in challenged volunteers compared with healthy controls . The observation that HlyE-specific T cell clones recognize different typhoidal strains with varying efficiency indicates potential challenges in developing broadly protective vaccines that should be carefully evaluated.

How should researchers interpret differences in HlyE recognition by T cell clones across different Salmonella strains?

The differential recognition of HlyE by T cell clones across Salmonella strains represents a complex immunological phenomenon that requires careful interpretation:

  • Strain-specific expression levels: The observation that HlyE-specific CD4+ T cell clones recognize cells infected with S. Typhi strain Ty21a more efficiently than cells infected with challenge strains S. Typhi Quailes and S. Paratyphi A NVGH308 suggests strain-dependent variations in HlyE expression levels. This is consistent with reports that Ty21a has increased HlyE-dependent hemolytic activity in vitro compared to other typhoidal strains .

  • Epitope variation analysis: Researchers should perform epitope mapping studies to determine if amino acid differences in HlyE between strains affect T cell recognition. Even minor sequence variations can significantly impact immunodominant epitope presentation.

  • Antigen processing differences: Variations in bacterial physiology between strains may alter HlyE processing and presentation pathways within antigen-presenting cells. Flow cytometry analysis of HLA-peptide complexes can help quantify these differences.

  • T cell receptor (TCR) affinity considerations: Different T cell clones may have varying TCR affinities for HlyE epitopes. Researchers should measure TCR-peptide/MHC binding affinities to determine if recognition differences are due to intrinsic T cell properties or antigen presentation variations.

These interpretations have important implications for both vaccine development and diagnostic test design, suggesting that strain selection for vaccine development and diagnostic antigen production should be carefully considered to maximize cross-protection or detection sensitivity.

What statistical approaches are most appropriate for analyzing HlyE aptamer binding data?

  • Binding curve analysis:

    • Fit binding data to appropriate models (typically one-site binding model: Y = Bmax×X/(Kd+X))

    • Determine dissociation constants (Kd) and maximum binding capacity (Bmax)

    • Use non-linear regression rather than linear transformations for more accurate Kd determination

    • Calculate 95% confidence intervals for all binding parameters

  • Comparative aptamer analysis:

    • Apply one-way ANOVA with post-hoc tests (Tukey or Bonferroni) to compare Kd values between different aptamers (e.g., AptHlyE11, AptHlyE45, AptHlyE97)

    • Use paired t-tests for comparing the same aptamer against different bacterial targets

  • Specificity assessment:

    • Calculate specificity indices as the ratio of binding to target (HlyE) versus non-target proteins

    • Implement receiver operating characteristic (ROC) curve analysis to determine optimal cutoff values for diagnostic applications

    • Report area under the curve (AUC) values with confidence intervals

  • Reproducibility evaluation:

    • Perform intra-assay (replicate measurements within same experiment) and inter-assay (measurements across different days) coefficient of variation calculations

    • Consider Bland-Altman plots for method comparison studies

The research finding that aptamers like AptHlyE97 demonstrated Kd values in the nanomolar range (83.6 nM) requires careful statistical validation using these approaches to confirm binding characteristics and support their potential use in diagnostic applications.

How can researchers resolve contradictory findings regarding HlyE expression in different experimental models?

Resolving contradictory findings regarding HlyE expression across different experimental models requires systematic investigation of potential confounding factors:

  • Standardized growth condition comparison:

    • Establish a matrix of standardized growth conditions (aerobic vs. microaerobic, rich vs. minimal media, different pH values)

    • Measure HlyE expression across all conditions for different Salmonella strains

    • Determine if strain-specific differences are consistent or condition-dependent

  • In vitro versus in vivo expression analysis:

    • Compare HlyE expression in laboratory culture versus within host cells (macrophages, epithelial cells)

    • Use reporter gene constructs (e.g., hlyE promoter-GFP fusions) to monitor expression in real-time during infection

    • Validate with transcript and protein quantification from infected tissues

  • Technical variation elimination:

    • Standardize protein extraction protocols across laboratories

    • Implement absolute quantification methods (e.g., selected reaction monitoring mass spectrometry with isotope-labeled standards)

    • Establish reference strains and positive controls for inter-laboratory comparisons

  • Genetic background considerations:

    • Investigate the impact of regulatory gene variations between strains on HlyE expression

    • Create isogenic strains differing only in hlyE regulatory regions to isolate genetic effects

The apparent contradiction observed between HlyE expression levels in different typhoidal strains and the finding that the Ty21a vaccine strain shows increased HlyE-dependent hemolytic activity in vitro compared to other strains likely reflects complex regulatory mechanisms that should be systematically examined using these approaches.

What emerging technologies could enhance detection and characterization of HlyE?

Several emerging technologies show promise for advancing HlyE detection and characterization:

  • CRISPR-based detection platforms:

    • Cas12/Cas13-based detection systems could be developed using aptamers as recognition elements

    • Such systems could achieve sub-picomolar sensitivity with lateral flow visualization

    • This approach would enable rapid, instrument-free detection suitable for field use in endemic regions

  • Single-molecule analysis techniques:

    • Single-molecule FRET to characterize HlyE pore formation dynamics in real-time

    • Super-resolution microscopy to visualize HlyE distribution during host cell interaction

    • Nanopore sensing for direct detection of HlyE in clinical samples

  • Advanced structural biology approaches:

    • Cryo-electron microscopy to resolve high-resolution structures of HlyE pore complexes

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes during pore formation

    • Molecular dynamics simulations to predict stability and function of HlyE variants

  • Machine learning algorithms:

    • Development of predictive models for HlyE expression based on patient metadata

    • Automated image analysis for HlyE-induced cell morphology changes

    • Pattern recognition in mass spectrometry data for direct HlyE detection in complex samples

Integration of these technologies with established aptamer-based detection methods could dramatically improve sensitivity and specificity while reducing detection time and resource requirements, addressing urgent needs for typhoid diagnostics in resource-limited settings.

What are the key questions remaining about the immunological response to HlyE?

Despite significant progress, several critical questions about immunological responses to HlyE remain unanswered:

  • Epitope hierarchy and immunodominance:

    • Which HlyE epitopes are immunodominant in natural infection versus vaccination?

    • Do immunodominant epitopes vary between different human populations or MHC haplotypes?

    • How does epitope recognition evolve during the course of infection?

  • Cross-protective potential:

    • Can immunity against S. Typhi HlyE protect against S. Paratyphi A infection?

    • What degree of sequence conservation is required for cross-protection?

    • How do structural differences impact cross-protective potential?

  • Correlates of protection:

    • What specific immune responses (antibody isotypes, T cell subsets) correlate with protection?

    • Are anti-HlyE antibodies neutralizing, and if so, which epitopes do they target?

    • How long does HlyE-specific immunity persist after natural infection or vaccination?

  • Host-pathogen interaction dynamics:

    • How does HlyE interact with pattern recognition receptors in the innate immune system?

    • What is the role of HlyE in modulating inflammatory responses during infection?

    • How do host genetic factors influence susceptibility to HlyE-mediated effects?

Addressing these questions will require comprehensive immunological studies in both animal models and human populations, with particular emphasis on comparing responses between individuals with different infection outcomes (symptomatic versus asymptomatic, cleared versus persistent infection).

How might insights from HlyE research translate to novel therapeutic approaches?

The detailed understanding of HlyE structure, function, and immunology provides several promising avenues for therapeutic development:

  • Targeted anti-virulence strategies:

    • Development of small molecule inhibitors of HlyE pore formation

    • Design of peptide-based inhibitors targeting the membrane insertion domain

    • Creation of antibody-drug conjugates directed against surface-exposed HlyE epitopes

  • Novel vaccine approaches:

    • Rational epitope-focused vaccines incorporating immunodominant HlyE epitopes

    • Attenuated strains with modulated HlyE expression for balanced immunogenicity

    • mRNA vaccines encoding optimized HlyE constructs for enhanced presentation

  • Immunomodulatory therapeutics:

    • Exploitation of HlyE-specific T cell responses to enhance bacterial clearance

    • Development of immune checkpoint modulators to reverse potential HlyE-mediated immunosuppression

    • Chimeric antigen receptor (CAR) T cell approaches targeting Salmonella-infected cells

  • Diagnostic-therapeutic combinations:

    • Integration of aptamer-based detection with targeted drug delivery

    • Point-of-care systems that simultaneously diagnose infection and initiate treatment

    • Theranostic approaches using HlyE-targeted nanoparticles for both imaging and drug delivery

The finding that HlyE is an essential virulence factor required for bacterial survival within host macrophages makes it a particularly attractive target for anti-virulence strategies that could complement conventional antibiotics. Additionally, the demonstrated immunogenicity of HlyE in human infection suggests its potential value in vaccine development efforts targeting both S. Typhi and S. Paratyphi A.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.