Recombinant Salmonella paratyphi A Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Biochemical and Functional Overview

MsbA is a homodimeric ABC transporter composed of two subunits, each containing:

  • Transmembrane domain (TMD): Forms the substrate-binding cavity.

  • Nucleotide-binding domain (NBD): Binds ATP and facilitates conformational changes.

Key functions include:

  • Lipid A transport: Flips lipid A from the cytoplasmic to the periplasmic leaflet of the inner membrane, a step essential for LPS biosynthesis .

  • Antibiotic efflux: Contributes to multidrug resistance by exporting amphipathic drugs .

  • Phospholipid translocation: Facilitates ATP-dependent flipping of phospholipids (e.g., phosphatidylethanolamine, PE) in vitro .

Domain Architecture

FeatureDescriptionSource
TMD12 transmembrane helices arranged in two bundles (TM1-6 and TM7-12)
NBDWalker A and B motifs for ATP hydrolysis; flexible hinge for conformational changes
Conformational StatesAlternates between inward-facing (cytoplasmic) and outward-facing (periplasmic) states

ATPase Activity

SubstrateATPase Activity (nmol ATP/mg/min)ConditionsSource
Lipid A~7.7 nmol/min/mgReconstituted proteoliposomes
NBD-PE~7.7 nmol/min/mgE. coli lipid mixture

Substrate Specificity

SubstrateBinding Affinity (Kd)InhibitorsSource
Lipid ALow micromolar rangeDaunorubicin, vinblastine
PhospholipidsVariable (PE > PC > SM)Lipid A, amphipathic drugs

Diagnostic Potential

  • Metabolomic profiling: Metabolite signatures differentiate Salmonella Typhi and Paratyphi A infections, though MsbA itself is not a direct biomarker .

Antibiotic Resistance

  • Efflux mechanism: MsbA homologs in E. coli and Salmonella confer resistance to nitroimidazole antibiotics .

Challenges and Future Directions

  • Functional ambiguity: MsbA’s role in phospholipid trafficking remains debated, though in vitro assays confirm flippase activity .

  • Therapeutic targeting: Inhibiting MsbA could disrupt LPS synthesis and antibiotic efflux, but structural plasticity complicates drug design .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your desired tag type for preferential development.
Synonyms
msbA; SPA1814; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-582
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
msbA
Target Protein Sequence
MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGIALILNAASDTFMLSLLKPLLDDGFGKTD RSVLLWMPLVVIGLMILRGITSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSI AIRVVSKRFRSISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFAILDSEQEKDEGKRVIDRATGDLEFRNVTFTYPGREVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLMIAHRLS TIEQADEIVVVEDGIIVERGTHSELLAQHGVYAQLHKMQFGQ
Uniprot No.

Target Background

Function
MsbA is involved in lipopolysaccharide (LPS) biosynthesis. It translocates the lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) provides the necessary energy for this process.
Database Links

KEGG: spt:SPA1814

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Salmonella paratyphi A MsbA protein?

MsbA is an essential ATP-binding cassette (ABC) transporter found in many Gram-negative bacteria, including Salmonella paratyphi A. It functions as a homodimeric transporter responsible for the translocation of lipopolysaccharide Lipid A anchor and various cytotoxic agents across the bacterial inner membrane .

The protein consists of 582 amino acids (UniProt ID: Q5PGH0) and contains characteristic domains typical of ABC transporters: two nucleotide-binding domains (NBDs) that bind and hydrolyze ATP, and two membrane domains (MDs) that form the substrate translocation pathway . MsbA from S. paratyphi A strain ATCC 9150/SARB42 shares significant structural similarity with homologous transporters like P-glycoprotein (ABCB1) in mammals and bacterial LmrA .

The functional significance of MsbA lies in its essential role in bacterial viability - as it transports newly synthesized Lipid A to the outer membrane, a critical component of the protective outer membrane of Gram-negative bacteria.

How does MsbA's energy coupling mechanism differ from other ABC transporters?

Recent research has revealed a unique aspect of MsbA's transport mechanism that distinguishes it from the classical understanding of ABC transporters. While traditional models suggest that ABC transporters exclusively utilize ATP hydrolysis for substrate translocation, MsbA demonstrates a more complex energy coupling system.

MsbA has been found to couple substrate transport not only to ATP binding and hydrolysis but also to a transmembrane electrochemical proton gradient . This dual energy utilization suggests a more sophisticated and energy-efficient transport mechanism than previously understood. The dependence of ATP-dependent transport on proton coupling, and the stimulation of MsbA-ATPase activity by chemical proton gradients highlight the functional integration of both forms of metabolic energy .

This finding introduces ion coupling as a critical parameter in understanding the mechanistic function of homodimeric ABC transporters, challenging previous models that attributed transport solely to ATP hydrolysis at the NBDs.

What are the recommended storage and handling conditions for recombinant MsbA protein in laboratory settings?

For optimal stability and functionality of recombinant MsbA protein:

  • Store the purified protein at -20°C for routine laboratory use, or at -80°C for extended storage periods .

  • Maintain the protein in Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein .

  • Avoid repeated freeze-thaw cycles, as these can significantly reduce protein activity and structural integrity .

  • For experiments requiring multiple uses, prepare working aliquots and store at 4°C for up to one week to minimize degradation .

  • When handling the protein, maintain temperature control to prevent denaturation, particularly during experimental procedures.

What methodologies are most effective for expressing and purifying recombinant MsbA protein?

The effective expression and purification of functional MsbA requires careful consideration of expression systems and purification strategies:

Expression Systems:

  • E. coli-based expression: Using BL21(DE3) or C41(DE3) strains with pET-based vectors containing the msbA gene from Salmonella paratyphi A.

  • Induction conditions: Optimal expression typically occurs with 0.5-1 mM IPTG induction at lower temperatures (18-25°C) for 4-12 hours to maximize properly folded protein yield.

Purification Protocol:

  • Membrane extraction: Lyse cells and isolate membranes through differential centrifugation.

  • Solubilization: Extract MsbA using detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG).

  • Affinity chromatography: Purify using Ni-NTA or similar columns if the construct contains a His-tag.

  • Size exclusion chromatography: Further purify to obtain homogeneous protein preparation.

The tag choice should be determined during the production process based on experimental needs, though histidine tags are commonly used for initial purification steps .

How can researchers assess the functional activity of purified MsbA protein?

Several complementary assays can be employed to assess MsbA's transport and ATPase activities:

ATPase Activity Assays:

  • Colorimetric phosphate release assays: Measure inorganic phosphate released during ATP hydrolysis using malachite green or similar reagents.

  • Coupled enzyme assays: Monitor ATP consumption using pyruvate kinase and lactate dehydrogenase with spectrophotometric detection of NADH oxidation.

Transport Activity Assays:

  • Reconstitution in proteoliposomes: Incorporate purified MsbA into liposomes to create a membrane system for transport studies.

  • Fluorescent substrate transport: Use fluorescently labeled lipids or drugs to monitor transport across the membrane.

  • Proton gradient coupling experiments: Establish pH gradients and measure transport rates in the presence and absence of ionophores to assess proton coupling.

Assay TypeMeasurement ParameterAdvantagesLimitations
Malachite Green ATPase AssayInorganic phosphateSimple, quantitativeEndpoint measurement
Coupled Enzyme ATPase AssayNADH oxidationReal-time kineticsComplex setup
Proteoliposome TransportSubstrate translocationDirect functional assessmentTechnical complexity
Proton Gradient CouplingTransport with/without pH gradientEvaluates energy couplingRequires specialized equipment

What structural analysis techniques provide the most valuable insights into MsbA conformational states?

Understanding the structural dynamics of MsbA during its transport cycle requires sophisticated structural biology approaches:

  • X-ray crystallography: Provides high-resolution static structures of MsbA in different conformational states, though crystallization of membrane proteins presents technical challenges.

  • Cryo-electron microscopy (cryo-EM): Increasingly valuable for membrane protein structure determination, allowing visualization of MsbA in near-native conditions without crystallization.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies regions of conformational flexibility and solvent accessibility changes during the transport cycle.

  • Site-directed spin labeling with electron paramagnetic resonance (EPR): Monitors distances between specific residues during conformational changes.

  • Double electron-electron resonance (DEER): Measures longer distances between domains during the transport cycle.

  • Molecular dynamics simulations: Complements experimental data by predicting protein movements and substrate interactions in membrane environments.

How does MsbA contribute to Salmonella pathogenicity island function and virulence?

MsbA plays an indirect but crucial role in Salmonella pathogenicity through its essential function in outer membrane biogenesis:

  • Lipopolysaccharide transport: By facilitating the transport of Lipid A, which anchors LPS to the outer membrane, MsbA contributes to the formation of the protective barrier that shields bacteria from host immune defenses .

  • Relationship with Salmonella pathogenicity islands (SPIs): While MsbA is not encoded within SPIs, its function is critical for maintaining outer membrane integrity, which in turn supports the proper function of virulence factors encoded by SPIs .

  • Impact on secretion systems: The type 3 secretion systems (T3SS) encoded by SPI-1 and SPI-2 require proper membrane organization to function effectively. MsbA's role in lipid transport contributes to maintaining the membrane environment necessary for T3SS assembly and operation .

  • Antibiotic resistance connection: MsbA can transport certain antibiotics, contributing to intrinsic resistance mechanisms that complement resistance genes carried on plasmids and other mobile genetic elements .

Researchers investigating MsbA in the context of pathogenicity should consider these connections when designing experiments to study virulence factor expression and function.

What experimental approaches can differentiate between MsbA's role in Lipid A transport versus its function in drug efflux?

Distinguishing between MsbA's dual functions requires carefully designed experiments:

Lipid A Transport Assessment:

  • Radiolabeled or fluorescently labeled Lipid A precursors: Track the movement of these molecules from inner to outer membrane.

  • Mass spectrometry analysis: Quantify Lipid A modifications and localization in wild-type versus MsbA-deficient or mutant strains.

  • LPS composition analysis: Examine outer membrane LPS profiles using gel electrophoresis followed by silver staining.

Drug Efflux Function:

  • Fluorescent substrate accumulation assays: Measure intracellular accumulation of fluorescent MsbA substrates in the presence of ATP or proton gradient disruptors.

  • Resistance profile testing: Compare minimum inhibitory concentrations (MICs) of known MsbA substrates in strains with wild-type versus modified MsbA.

  • Competitive transport assays: Assess how Lipid A and drug substrates compete for transport, revealing binding site overlap or separation.

Comparative Mutation Analysis:
Introduce specific mutations that selectively impact one function but not the other, then measure both Lipid A transport and drug efflux capacities to determine functional separation.

How do the ATP-binding and proton gradient coupling mechanisms integrate in MsbA's transport cycle?

Recent discoveries about MsbA's dual energy utilization raise fundamental questions about the coordination between ATP hydrolysis and proton coupling:

The integration of ATP binding/hydrolysis and proton gradient coupling in MsbA follows a complex mechanism that can be conceptualized as follows:

  • Sequential or simultaneous energy utilization: Research suggests that MsbA may use proton gradients to facilitate conformational changes that are further powered by ATP hydrolysis, creating an energy-efficient transport system .

  • Conformational coupling mechanism: ATP binding and hydrolysis at the NBDs induce conformational changes in the MDs, while proton binding and release at key residues in the transmembrane helices may facilitate these movements or provide additional energy for substrate translocation.

  • Experimental approach to study integration: Researchers can systematically vary ATP concentrations and proton gradient strengths while measuring transport rates to establish the relationship between these energy sources.

Experimental ConditionATP UtilizationProton Gradient UtilizationTransport Efficiency
High ATP, High ΔpHMaximumMaximumMaximum
High ATP, Low ΔpHMaximumMinimumIntermediate
Low ATP, High ΔpHMinimumMaximumIntermediate
Low ATP, Low ΔpHMinimumMinimumMinimum

This conceptual framework guides investigations into the precise molecular mechanisms of energy integration in MsbA transport.

What are the key considerations in designing site-directed mutagenesis experiments to map the substrate binding sites of MsbA?

Mapping the substrate binding sites of MsbA through site-directed mutagenesis requires strategic planning:

  • Target selection strategy:

    • Focus on residues in the transmembrane domains that line the putative substrate pathway

    • Prioritize charged and aromatic residues that often participate in substrate binding

    • Target conserved residues across MsbA homologs but divergent from non-substrate-transporting relatives

  • Mutation design principles:

    • Conservative substitutions (e.g., Leu to Ile) to test structural roles

    • Charge reversals (e.g., Lys to Glu) to test electrostatic interactions

    • Aromatic to alanine substitutions to disrupt π-stacking or hydrophobic interactions

  • Functional assessment of mutants:

    • Measure both ATPase activity and substrate transport to distinguish binding defects from coupling defects

    • Compare effects on different substrates (Lipid A versus drugs) to identify substrate-specific binding regions

    • Determine kinetic parameters (Km, Vmax) for wild-type and mutant proteins to quantify effects

  • Structural validation:

    • Complement mutagenesis with structural studies of wild-type and key mutants

    • Use computational docking and molecular dynamics to predict and refine binding site models

    • Employ photoaffinity labeling with substrate analogs to directly identify binding residues

How can researchers investigate the potential interactions between MsbA and other bacterial membrane systems?

MsbA likely functions within a complex network of membrane protein interactions that influence bacterial physiology and pathogenesis:

Methodological approaches to study MsbA interactions:

  • Protein-protein interaction identification:

    • Pull-down assays with tagged MsbA to isolate interacting partners

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Chemical cross-linking followed by mass spectrometry (XL-MS)

    • Proximity labeling techniques (e.g., BioID) to identify proteins in the vicinity of MsbA

  • Functional interaction assessment:

    • Genetic suppressor screens to identify genes that compensate for partial MsbA deficiency

    • Synthetic lethality analyses to find genes essential only when MsbA function is compromised

    • Lipidomic and metabolomic analyses of outer membrane composition in response to MsbA modulation

  • Potential interaction partners to investigate:

    • LPS biosynthesis enzymes that produce MsbA substrates

    • Outer membrane assembly machinery that receives MsbA-transported Lipid A

    • Other ABC transporters that might compensate for or complement MsbA function

    • Components of the bacterial stress response that might regulate MsbA activity

What are the prospects for developing MsbA inhibitors as novel antimicrobial agents?

The essential nature of MsbA in Gram-negative bacteria makes it an attractive target for antimicrobial development:

  • Target validation considerations:

    • MsbA is essential for viability in many Gram-negative bacteria, including pathogens

    • Its high conservation across species suggests broad-spectrum potential

    • Differences from human homologs (like P-glycoprotein) could allow selective targeting

  • Inhibitor design approaches:

    • ATP-competitive inhibitors that prevent nucleotide binding and hydrolysis

    • Allosteric inhibitors that lock the transporter in non-functional conformations

    • Substrate-competitive inhibitors that block the translocation pathway

    • Proton coupling disruptors that interfere with the electrochemical gradient utilization

  • Screening methodologies:

    • High-throughput ATPase assays to identify initial hits

    • Secondary transport assays to confirm functional inhibition

    • Bacterial growth inhibition assays to validate cellular activity

    • Structure-based virtual screening using solved MsbA structures

  • Challenges and considerations:

    • Membrane permeability of inhibitors to reach the inner membrane target

    • Potential for rapid resistance development through mutations or compensatory mechanisms

    • Selectivity over human ABC transporters to minimize toxicity

How might advanced structural biology techniques enhance our understanding of MsbA conformational dynamics?

Recent advances in structural biology offer new opportunities for understanding the dynamic nature of MsbA function:

  • Time-resolved cryo-EM:

    • Captures transient conformational states during the transport cycle

    • Can be combined with substrate and ATP analogs to trap specific intermediates

    • Offers potential to visualize the complete conformational landscape of transport

  • Single-molecule FRET spectroscopy:

    • Monitors real-time conformational changes in individual MsbA molecules

    • Can reveal conformational heterogeneity not apparent in ensemble measurements

    • Allows correlation of conformational states with functional outcomes

  • Integrative structural approaches:

    • Combines multiple experimental techniques (crystallography, cryo-EM, EPR, HDX-MS, etc.)

    • Computational modeling to fill gaps between experimental data points

    • Creates dynamic models of the complete transport cycle

  • In-cell structural biology:

    • Developing methods to study MsbA structure and dynamics in native bacterial membranes

    • Cryo-electron tomography of bacterial membranes with genetically tagged MsbA

    • In-cell NMR or EPR to assess conformational states in living bacteria

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.