Recombinant Salmonella paratyphi A Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Functional Role of LspA

LspA is a type II signal peptidase responsible for cleaving the signal peptide of prolipoproteins, enabling their maturation and localization to the bacterial outer membrane . This enzymatic activity is indispensable for:

  • Lipoprotein processing: Critical for stabilizing membrane integrity and facilitating interactions with host cells .

  • Virulence modulation: Lipoproteins contribute to bacterial invasion, immune evasion, and cytokine induction .

  • Secretion pathway regulation: Coordinates with other peptidases (e.g., LepB, SPase I) to manage protein trafficking through the Sec pathway .

Gene Expression Dynamics

Transcriptional profiling of lspA in Rickettsia typhi (a model organism) reveals its expression kinetics during intracellular growth :

Post-Infection Time (h)lspA Expression Levellgt Expression LevellepB Expression Level
0 (Preinfection)HighHighHigh
8LowLowLow
48PeakPeakPeak
120DeclineDeclineDecline
  • Key observations:

    • lspA and lgt (prolipoprotein transferase) exhibit parallel expression patterns, emphasizing their cooperative role in lipoprotein maturation .

    • lepB (SPase I) shows higher expression than lspA, indicating its dominance in nonlipoprotein secretion .

Recombinant LspA Applications

Though no direct data exists for S. Paratyphi A LspA, studies on recombinant LspA homologs highlight its utility:

  • Functional complementation: Recombinant R. typhi LspA restored growth in E. coli mutants deficient in SPase II, confirming its enzymatic activity .

  • Antigen engineering: Lipoproteins like H1a (flagellin) and SpaO (invasion factor) in S. Paratyphi A are immunogenic vaccine targets . LspA-processed lipoproteins may enhance antigen presentation.

  • Antibiotic resistance: Overexpression of lspA in E. coli increased resistance to globomycin, a SPase II inhibitor .

Implications for Vaccine Development

Lipoproteins processed by LspA are pivotal in Salmonella pathogenesis and immune evasion:

  • Protective immunity: Recombinant lipoproteins (e.g., H1a and SpaO) elicited IgG responses in mice, with co-immunization achieving 75–92% protection against lethal S. Paratyphi A challenges .

  • Conjugate vaccines: O-antigen glycoconjugates (e.g., O:2-CRM197) induce bactericidal antibodies against diverse S. Paratyphi A isolates, independent of O-acetylation or glucosylation variations .

Genomic and Phenotypic Variability

Recent genomic analyses of S. Paratyphi A isolates reveal:

  • Clade-specific traits: The Paratype scheme identifies 18 genotypes with distinct antimicrobial resistance (AMR) profiles and virulence markers .

  • Enhanced virulence: Outbreak strains exhibit increased motility, intracellular survival, and IL-8 induction compared to reference strains .

Future Research Directions

  • Structural characterization: Resolve the 3D structure of S. Paratyphi A LspA to guide inhibitor design.

  • In vivo validation: Assess LspA knockout mutants for attenuated virulence and vaccine potential.

  • Cross-species studies: Leverage insights from R. typhi LspA to hypothesize mechanisms in Salmonella.

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your desired format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: Our standard shipping method includes normal blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Store at -20°C/-80°C. Our standard protocol includes a 50% glycerol final concentration, which can be used as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
In general, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use to minimize repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize fulfilling your request.
Synonyms
lspA; SSPA0044; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
lspA
Target Protein Sequence
MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPSLNLHYARNYGAAFSF LADSGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGDWHFATFNLADTAICIGAALIVLEGFLPKPTAKEQA
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: sek:SSPA0044

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (lspA) in Salmonella paratyphi A and how is it characterized?

Lipoprotein signal peptidase (lspA) in Salmonella paratyphi A is an essential membrane-bound enzyme that functions in the processing of bacterial prolipoproteins by cleaving the signal peptide after lipid modification. As a type II signal peptidase, lspA specifically recognizes the lipobox motif (typically L-[A/S/T]-[G/A]-C) in prolipoproteins after the cysteine residue has been lipid-modified by diacylglyceryl transferase. In Salmonella paratyphi A, lspA contains approximately 164 amino acids and is anchored to the cytoplasmic membrane through multiple transmembrane domains. The enzyme plays a critical role in bacterial envelope integrity and certain virulence mechanisms.

For characterization, researchers typically employ techniques such as:

  • PCR amplification of the lspA gene using primers designed from conserved regions

  • DNA sequencing to confirm gene identity and identify polymorphisms

  • SDS-PAGE and Western blotting with specific antibodies to detect the protein

  • Enzymatic activity assays using fluorogenic peptide substrates

What experimental systems are most suitable for studying recombinant lspA expression?

When expressing recombinant Salmonella paratyphi A lspA, several expression systems have proven effective, each with specific advantages depending on research goals:

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coli BL21(DE3)High yield, well-established protocolsPotential toxicity, inclusion body formationInduction with 0.1-0.5mM IPTG at 16-20°C overnight
Regulated arabinose-inducible systemsTunable expression, reduced toxicityLower yield than IPTG systems0.2-2% arabinose, 30°C for 4-6 hours
Cell-free expressionAvoids toxicity issues, rapid resultsHigher cost, lower yield30°C, 4-6 hours with membrane mimetics
RDAS systemControlled expression timing, suitable for in vivo studiesMore complex setuparaC PBAD regulation as described in Salmonella vaccine vectors

For membrane proteins like lspA, expression with a fusion tag (e.g., His6, MBP, or SUMO) often improves solubility and facilitates purification. When designing constructs, it's essential to include appropriate detergents (e.g., DDM, LDAO) during purification to maintain protein structure and function .

What methodologies are most effective for analyzing lspA's role in S. paratyphi A virulence?

Investigating lspA's contribution to S. paratyphi A virulence requires sophisticated approaches that connect enzymatic function to pathogenesis:

  • Gene deletion and complementation studies:

    • Construction of precise in-frame lspA deletion mutants using λ Red recombinase system

    • Complementation with both wild-type lspA and site-directed mutants

    • Phenotypic assessment under various stress conditions (e.g., bile salts, antimicrobial peptides)

  • In vitro infection models:

    • Human macrophage infection assays (THP-1 or primary monocyte-derived macrophages)

    • Assessment of inflammasome activation via caspase-1, caspase-4, and caspase-8 activity measurements

    • Quantification of IL-1β secretion and pyroptotic cell death (PI uptake)

    • Epithelial cell invasion and intracellular replication assays

  • Lipoprotein profiling:

    • Comparative proteomics of membrane fractions from wild-type vs. lspA mutants

    • Mass spectrometry identification of accumulated prolipoproteins

    • Pulse-chase experiments to track lipoprotein maturation kinetics

  • Reporter systems:

    • Fusion of virulence-associated lipoproteins with reporters (GFP, luciferase)

    • Microscopy for subcellular localization and processing status

Research has shown that defects in lipoprotein processing through lspA can significantly impact bacterial envelope integrity, leading to attenuated virulence through multiple mechanisms including altered SPI-1 function and inflammasome activation . When conducting these experiments, it's crucial to maintain careful control over growth conditions, as environmental factors can significantly impact virulence gene expression.

How can recombinant S. paratyphi A lspA be incorporated into vaccine development strategies?

Recombinant S. paratyphi A lspA offers several promising avenues for vaccine development:

  • As a component in subunit vaccines:

    • Purified recombinant lspA can be formulated with appropriate adjuvants

    • Epitope mapping to identify immunodominant regions for peptide vaccines

    • Conjugation to carrier proteins for enhanced immunogenicity

  • As a target for attenuated live vaccines:

    • Construction of temperature-sensitive lspA mutants that maintain viability but have reduced virulence

    • Regulated expression systems like RDAS (Regulated Delayed Antigen Synthesis) where lspA expression is controlled by arabinose-regulated promoters

    • Heterologous antigen display on lipoproteins processed by controlled levels of lspA

  • As a tool for improving existing vaccine platforms:

    • Optimization of lipoprotein display on outer membrane vesicles (OMVs)

    • Engineering lipid modification of immunogens for enhanced immune recognition

A particularly promising approach involves the RDAS system, where the chromosomal repressor gene, lacI, is expressed from the arabinose-regulated araC PBAD promoter to regulate antigen synthesis. In this system, LacI production is controlled by arabinose availability, which decreases in vivo, allowing for programmed antigen expression after colonization has been established .

Vaccine StrategyKey AdvantagesTechnical Considerations
Subunit vaccineSafety, defined compositionTypically requires adjuvants, multiple doses
Live attenuated with lspA modificationStrong cellular and humoral responsesBalance between attenuation and immunogenicity
OMV-based with lspA-processed lipoproteinsNatural adjuvant properties, multiple antigensStandardization of preparation, stability
RDAS-regulated lspAControlled antigen delivery timingOptimization of promoter strength and repressor levels

When developing such vaccines, researchers should consider the Th1/Th2 balance, as Salmonella vaccines typically induce stronger Th1 responses with higher IgG2a than IgG1 titers, which correlates with effective protection .

What is the relationship between lspA function and inflammasome activation during S. paratyphi A infection?

The relationship between lspA processing and inflammasome activation represents a critical intersection between bacterial physiology and host immune responses:

  • Mechanistic connections:

    • Properly processed bacterial lipoproteins can be recognized by host TLR2, priming inflammasome activation

    • Accumulation of improperly processed lipoproteins due to lspA dysfunction may alter outer membrane integrity

    • Modified membrane integrity can affect SPI-1 T3SS function, which is critical for inflammasome activation

    • Lipoprotein processing affects O-antigen presentation, which can modulate inflammasome responses

  • Experimental approaches:

    • Assessment of pyroptosis in human macrophages using PI uptake and LDH release assays

    • Measurement of caspase-1, caspase-4, and caspase-8 activation through western blotting

    • Quantification of IL-1β and IL-18 secretion by ELISA

    • siRNA knockdown of key inflammasome components to determine specific pathways

Research with S. paratyphi A has shown that it induces GSDMD-mediated pyroptosis via activation of caspase-1, caspase-4, and caspase-8 pathways. The SPI-1 T3SS is essential for this process, as no cell death occurs in the absence of functional SPI-1 injectisome . Interestingly, the very long O-antigen chains in S. paratyphi A, regulated by FepE, interfere with bacterial interactions with epithelial cells and impair inflammasome-mediated macrophage cell death .

This research suggests that lspA-dependent lipoprotein processing could influence inflammasome activation through:

  • Altered membrane composition affecting SPI-1 T3SS assembly or function

  • Modified O-antigen presentation due to changes in membrane architecture

  • Direct recognition of improperly processed lipoproteins by host sensors

How do mutations in lspA affect bacterial survival and pathogenesis mechanisms?

Mutations in lspA have profound effects on bacterial physiology and pathogenesis through multiple mechanisms:

  • Envelope integrity and stress responses:

    • Accumulation of unprocessed prolipoproteins disrupts membrane architecture

    • Increased sensitivity to membrane-targeting antimicrobials and detergents

    • Activation of envelope stress responses (σE, Cpx, Rcs)

    • Altered outer membrane vesicle (OMV) formation and composition

  • Effects on virulence mechanisms:

    • Impaired SPI-1 and SPI-2 type III secretion system function

    • Reduced biofilm formation capacity

    • Altered motility due to flagellar dysfunction

    • Compromised iron acquisition systems that depend on lipoprotein transporters

  • Host-pathogen interactions:

    • Modified recognition by host pattern recognition receptors

    • Altered inflammasome activation patterns

    • Changed intracellular survival in macrophages

    • Decreased ability to evade host immune responses

Methodologically, researchers can study these effects through:

  • Systematic site-directed mutagenesis of catalytic residues

  • Transcriptomic and proteomic profiling of mutant strains

  • Membrane permeability assays (e.g., NPN uptake, PI staining)

  • In vitro and in vivo infection models with competitive index assays

When analyzing S. paratyphi A lspA mutants, it's essential to consider the potential polar effects on downstream genes and to verify phenotypes through complementation. Additionally, the impact of mutations may vary depending on growth conditions and infection models used.

What techniques are most effective for studying lspA-substrate interactions and inhibitor development?

Understanding lspA-substrate interactions requires specialized techniques due to the membrane-embedded nature of this enzyme:

  • Structural characterization approaches:

    • X-ray crystallography of detergent-solubilized or lipid cubic phase preparations

    • Cryo-electron microscopy for membrane protein structures

    • NMR studies with isotopically labeled proteins for dynamics analysis

    • Molecular dynamics simulations to predict substrate binding

  • Biochemical interaction assays:

    • Surface plasmon resonance with immobilized lspA

    • Microscale thermophoresis for quantifying binding affinities

    • FRET-based assays for real-time monitoring of substrate processing

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Inhibitor development methodologies:

    • High-throughput screening using fluorogenic peptide substrates

    • Fragment-based drug discovery approaches

    • Structure-based virtual screening and molecular docking

    • Peptidomimetic design based on substrate recognition motifs

TechniqueApplicationAdvantagesLimitations
Fluorogenic substrate assaysEnzymatic activityQuantitative, real-timeLimited physiological relevance
Proteomics of accumulated substratesSubstrate identificationComprehensive, unbiasedIndirect, may include secondary effects
Site-directed mutagenesisFunctional residue mappingPrecise mechanism insightsLabor-intensive, may affect protein stability
In silico dockingInhibitor discoveryRapid, cost-effectiveRequires validation, model accuracy dependent

For inhibitor development, researchers should focus on compounds that specifically target lspA without affecting human peptidases. Since lspA is a unique bacterial enzyme with no human homolog, it represents an attractive antimicrobial target. Recent advances in membrane protein structural biology have facilitated more rational approaches to inhibitor design for these challenging targets.

What are the current gaps in our understanding of S. paratyphi A lspA and future research directions?

Despite significant advances, several key knowledge gaps remain in our understanding of S. paratyphi A lspA:

  • Structural characterization: Limited high-resolution structural data for S. paratyphi A lspA compared to other bacterial enzymes

  • Substrate specificity: Incomplete catalog of specific lipoproteins processed by lspA in S. paratyphi A and their prioritization during infection

  • Regulatory mechanisms: Poor understanding of how lspA expression is regulated under different environmental conditions

  • Host-specific adaptations: Unclear how lspA function may be adapted to the human host compared to other Salmonella species

  • Vaccine applications: Need for optimized strategies to incorporate lspA targeting in vaccine development

Priority future research directions should include:

  • Comprehensive structural characterization of S. paratyphi A lspA

  • Systems-level analysis of lipoprotein processing during different infection stages

  • Development of lspA-targeted inhibitors as potential therapeutics

  • Optimization of regulated expression systems like RDAS for vaccine applications

  • Elucidation of the relationship between lspA function and inflammasome modulation

The continuing challenge of enteric fever, especially due to increasing antimicrobial resistance, underscores the importance of understanding fundamental pathogenic mechanisms like lspA function to develop novel intervention strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.