Recombinant Salmonella paratyphi A NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Identification and Basic Properties

NADH-quinone oxidoreductase subunit A, also known as NuoA, is a subunit of the NADH-quinone oxidoreductase (NDH-1) complex, which is involved in oxidoreductase activity, acting on NADH or NADPH . The gene name associated with NuoA is nuoA .

Table 1: NuoA Identification

PropertyValue
NameNADH-quinone oxidoreductase subunit A
SynonymsNot available in the provided context
Gene NamenuoA
Enzyme ClassNot available in the provided context
General FunctionOxidoreductase activity, acting on NADH or NADPH
Cellular LocationCell inner membrane; Multi-pass membrane protein

Function and Role in Electron Transport

NuoA is a component of the NDH-1 complex, which functions to shuttle electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain . In this process, the immediate electron acceptor for the enzyme is believed to be ubiquinone . The NDH-1 complex couples the redox reaction to proton translocation; for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane, thus conserving the redox energy in a proton gradient .

Inhibitor-Binding Site

The PSST subunit (NQO6 in bacteria), is identified as a target protein for [3H]TDP, rotenone, piericidin A, and other complex I inhibitors . The PSST subunit and its bacterial counterpart have highly conserved cysteine motifs in their primary structure and are therefore homologous candidate subunits for housing N2. These two subunits are located at the interface between the hydrophilic extramembrane portion and the hydrophobic intermembrane region .

Role in Anaerobic Respiration

NDH-1 is required for the anaerobic respiration of NADH using fumarate or DMSO as the terminal electron acceptors, thus implying that the enzyme can transfer electrons to menaquinone .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
nuoA; SSPA0500; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, translocating four protons across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy within a proton gradient.

Database Links

KEGG: sek:SSPA0500

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit A in Salmonella paratyphi A metabolism?

NADH-quinone oxidoreductase (Complex I) is a critical enzyme in the electron transport chain of Salmonella, functioning as the primary entry point for electrons from NADH into the respiratory chain. The nuoA subunit serves as one of the membrane components involved in proton translocation across the bacterial membrane. This process is essential for establishing the proton motive force that drives ATP synthesis.

In Salmonella, the NADH-quinone oxidoreductase complex plays a crucial role in adaptation to varying environmental conditions, particularly during host infection. The complex contributes to bacterial survival under oxidative stress conditions, similar to how Gre transcription factors help Salmonella adapt to oxidative stress by improving transcription elongation and fidelity of metabolic genes . The nuoA subunit, as part of this complex, contributes to maintaining redox balance and energy production during host colonization.

How conserved is the nuoA gene across different Salmonella serovars?

The nuoA gene is highly conserved across Salmonella serovars, reflecting its essential function in cellular respiration. Comparative genomic analyses reveal that nuoA shares approximately 95-98% sequence identity across various Salmonella enterica serovars, including S. Typhimurium, S. Enteritidis, and S. Paratyphi A. This conservation makes nuoA a potential candidate for developing broad-spectrum therapeutic targets.

When analyzing nuoA conservation, researchers should employ whole-genome sequencing (WGS) approaches similar to those used in molecular subtyping of Salmonella . High-quality single-nucleotide polymorphism (hqSNP) analysis can precisely identify variations in nuoA sequences across different serovars and strains, providing insights into evolutionary relationships and functional conservation.

What is known about the genetic organization of the nuo operon in Salmonella paratyphi A?

The nuo operon in Salmonella paratyphi A consists of 14 genes (nuoA-N) arranged in a single transcriptional unit. The nuoA gene is typically positioned at the 5' end of the operon, followed by nuoB, nuoC, and so on. This organization is similar to that found in other γ-proteobacteria.

Transcriptional regulation of the nuo operon responds to changes in oxygen availability and energy demands. Under aerobic conditions, expression increases to maximize energy production through oxidative phosphorylation. During oxygen limitation or host infection, alternative respiratory pathways may be utilized, affecting nuo operon expression.

What are the optimal vector systems for cloning Salmonella paratyphi A nuoA?

For successful cloning and expression of Salmonella paratyphi A nuoA, consider the following vector systems:

For membrane proteins like nuoA, vectors with moderate expression levels are often preferable to avoid overwhelming the membrane insertion machinery. When constructing expression plasmids, the approach used in Salmonella Gre factor studies can be adapted, where genes plus ~400bp upstream regions including native promoters were PCR amplified and cloned into restriction sites of low-copy vectors .

How can I optimize purification strategies for recombinant nuoA protein?

Purifying membrane proteins like nuoA requires specialized approaches:

  • Membrane Fraction Isolation: After cell lysis, separate membrane fractions through ultracentrifugation (100,000 × g for 1 hour) to concentrate the target protein.

  • Detergent Solubilization: Screen detergents for optimal solubilization while maintaining protein function. Start with milder detergents:

    • n-Dodecyl-β-D-maltoside (DDM) at 1-2%

    • Digitonin at 1-2%

    • LMNG at 0.5-1%

  • Affinity Chromatography: If using His-tagged constructs, employ IMAC purification with specific modifications for membrane proteins:

    • Include 0.02-0.05% detergent in all buffers

    • Use extended binding times (30-60 minutes)

    • Consider gradient elution with imidazole

  • Size Exclusion Chromatography: Apply as a polishing step to remove aggregates and ensure homogeneity.

  • Functional Verification: After purification, verify functional integrity through activity assays measuring electron transfer capacity.

What analytical methods can be used to assess the functionality of recombinant nuoA?

Several approaches can verify the functionality of recombinant nuoA:

  • Oxygen Consumption Assays: Measure respiration rates using oxygen electrodes, similar to methods described for Salmonella oxidative metabolism studies . Reconstitute purified nuoA with other Complex I components in proteoliposomes and monitor oxygen consumption when NADH is added.

  • Electron Transfer Activity: Employ spectrophotometric assays tracking the reduction of artificial electron acceptors like ferricyanide or dichlorophenolindophenol (DCPIP) in the presence of NADH.

  • Membrane Potential Measurements: Use fluorescent probes like DiSC3(5) to assess the protein's ability to contribute to membrane potential generation.

  • Complementation Studies: Express recombinant nuoA in nuoA-deficient strains and assess restoration of growth under conditions requiring functional NADH dehydrogenase activity. This approach parallels the complementation methods used for Gre factors in Salmonella .

  • NADH/NAD+ Ratio Analysis: Measure the impact of nuoA function on cellular redox state by quantifying NADH/NAD+ ratios using enzymatic cycling assays or HPLC methods.

How does nuoA interact with other subunits in the NADH-quinone oxidoreductase complex?

The nuoA subunit primarily interacts with nuoH, nuoJ, and nuoK to form part of the membrane domain of Complex I. These interactions can be studied through:

  • Crosslinking Studies: Use chemical crosslinkers like DSS or photoreactive crosslinkers to capture physical interactions between nuoA and other subunits.

  • Co-immunoprecipitation: Develop antibodies against nuoA or use epitope tags for pulldown experiments to identify interaction partners.

  • Bacterial Two-Hybrid Analysis: Adapt bacterial two-hybrid systems to screen for specific interactions between nuoA and other Complex I components.

  • Cryo-EM Analysis: For advanced structural studies, purify the entire Complex I for cryo-electron microscopy to determine the precise position and interactions of nuoA at near-atomic resolution.

How does nuoA function contribute to Salmonella paratyphi A virulence and adaptation during infection?

The nuoA subunit, as part of Complex I, plays several roles in Salmonella virulence:

  • Energy Production During Infection: nuoA contributes to ATP generation through oxidative phosphorylation, providing energy for various virulence processes.

  • Adaptation to Oxidative Stress: Similar to how Gre factors help Salmonella adapt to oxidative stress , Complex I activity helps maintain redox balance when Salmonella encounters host-derived reactive oxygen species.

  • Intracellular Survival: Within macrophages, nuoA function likely supports metabolic adaptations necessary for survival in the phagosomal environment.

  • Contribution to Disease-Specific Gene Expression: As part of energy metabolism, nuoA activity influences the expression of virulence genes, similar to how Salmonella enterica highly expressed genes are often disease-specific .

To study these contributions, researchers can construct nuoA deletion mutants using the λ-Red homologous recombination system, as described for other Salmonella genes . Primers should be designed with 5'-end overhangs homologous to regions immediately following the start codon and preceding the stop codon of nuoA, allowing for precise gene deletion.

What approaches can be used to study the role of nuoA in Salmonella adaptation to different host environments?

To investigate nuoA's role in host adaptation:

  • In vitro Environmental Mimicry: Expose wild-type and nuoA mutant Salmonella to conditions mimicking host environments:

    • Low pH (pH 4.5-5.5) to simulate stomach conditions

    • Bile salts (0.1-0.5%) for intestinal conditions

    • H₂O₂ treatment (400 μM) to simulate oxidative stress

    • Low oxygen to mimic intestinal lumen

  • Cell Culture Infection Models: Compare invasion and intracellular survival of wild-type and nuoA-deficient strains in:

    • Epithelial cells (e.g., Caco-2, HT-29)

    • Macrophages (e.g., THP-1, RAW264.7)

    • Dendritic cells

  • Transcriptomic Profiling: Use RNA-Seq to identify genes differentially expressed between wild-type and nuoA mutants under various conditions, revealing compensatory mechanisms or downstream effects.

  • Metabolite Analysis: Measure changes in key metabolites between wild-type and nuoA mutant strains using targeted LC-MS/MS, focusing on central carbon metabolism intermediates and redox-related compounds.

What site-directed mutagenesis approaches can be used to study critical residues in nuoA function?

For precise functional analysis of nuoA:

  • Alanine Scanning Mutagenesis: Systematically replace conserved residues with alanine to identify those critical for function. Focus on:

    • Transmembrane domains

    • Residues conserved across species

    • Predicted proton channel components

  • Structure-Guided Mutagenesis: Based on structural homology models, target residues predicted to interact with other Complex I components or participate in proton translocation.

  • Implementation Strategy:

    • Use overlap extension PCR or Q5 site-directed mutagenesis kits

    • Clone mutated genes into low-copy vectors like pWSK29

    • Express in ΔnuoA backgrounds for complementation assays

    • Assess function through growth curves, oxygen consumption, and NADH/NAD+ ratios

  • Quantification Methods: For functional assessment, measure electron transfer activity and oxygen consumption, similar to the polarographic oxygen measurements used in Salmonella studies .

How can whole-genome sequencing approaches be adapted for studying nuoA evolution and function?

Whole-genome sequencing (WGS) can provide valuable insights for nuoA research:

  • Evolutionary Analysis:

    • Compare nuoA sequences across Salmonella serovars using high-quality SNP (hqSNP) analysis

    • Identify positively selected residues that may indicate functional importance

    • Trace horizontal gene transfer events that might affect nuoA function

  • Adaptive Mutation Identification:

    • Sequence nuoA from strains adapted to specific environmental conditions

    • Use approaches similar to the SNP pipelines developed by US FDA CFSAN or US CDC Lyve-SET

    • Identify mutations that emerge under selective pressure

  • Suppressor Mutation Analysis:

    • Introduce a deleterious mutation in nuoA

    • Select for revertant strains with restored function

    • Use WGS to identify compensatory mutations, revealing functional networks

  • Data Analysis Pipeline:

    • Generate raw sequence data using Illumina or Oxford Nanopore platforms

    • Map reads to a reference genome using BWA or Bowtie2

    • Call variants using tools like GATK, FreeBayes, or SAMtools

    • Filter high-quality SNPs using stringent criteria to prevent misidentification of sequencing errors

How can I address insolubility issues with recombinant nuoA?

Membrane proteins like nuoA often present solubility challenges:

  • Expression Optimization:

    • Reduce induction temperature to 16-20°C

    • Decrease inducer concentration (e.g., 0.1-0.5 mM IPTG instead of 1 mM)

    • Use specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression

  • Solubilization Strategies:

    • Screen a panel of detergents (DDM, LMNG, digitonin, CHAPS)

    • Test mixed micelle systems (e.g., lipid/detergent mixtures)

    • Evaluate novel solubilization agents like SMALPs (styrene-maleic acid lipid particles)

  • Fusion Partner Approach:

    • Express nuoA with solubility-enhancing fusion partners (MBP, GST, SUMO)

    • Consider split-fusion approaches for membrane proteins

  • Cell-Free Expression:

    • Utilize cell-free protein synthesis systems supplemented with nanodiscs or liposomes

    • Directly incorporate the synthesized protein into a membrane environment

What controls should I include when assessing nuoA activity in vitro?

Proper controls are essential for reliable nuoA functional assays:

  • Negative Controls:

    • Heat-inactivated nuoA protein (95°C for 10 minutes)

    • Reactions without NADH substrate

    • Proteoliposomes without incorporated nuoA

    • Assays in the presence of specific Complex I inhibitors (rotenone, piericidin A)

  • Positive Controls:

    • Commercial Complex I from related species

    • Wild-type Salmonella membrane fractions

    • Purified recombinant Complex I from E. coli

  • Validation Approaches:

    • Perform assays under different pH conditions (pH 6.0-8.0)

    • Test temperature dependence (25-42°C)

    • Establish substrate concentration curves

    • Verify results using multiple independent protein preparations

  • Data Analysis:

    • Calculate specific activity normalized to protein concentration

    • Apply appropriate statistical tests (e.g., Student's t-test or ANOVA)

    • Present results as mean ± standard deviation from at least three independent experiments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.