Recombinant Salmonella paratyphi A NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs

In Stock

Cat. No.

BT2044029

Source

in vitro E.coli expression system

Synonyms

nuoK; SSPA0509; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K

Quick Inquiry

Description

Definition and Biological Context

Recombinant Salmonella paratyphi A NADH-quinone oxidoreductase subunit K (NuoK) is a genetically engineered protein component of the respiratory enzyme complex NADH dehydrogenase I (NDH-1). This subunit is part of the membrane-embedded domain of NDH-1, which catalyzes electron transfer from NADH to quinones in the aerobic respiratory chain, coupled with proton translocation across the membrane . The recombinant form is produced in E. coli expression systems for research applications .

Amino Acid Sequence and Domains

The full-length NuoK protein comprises 100 amino acids. Its sequence is:
MIPLTHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG .

Property	Details
Gene Name	nuoK
UniProt ID	B5BCM7
Protein Length	1–100 amino acids
Tags	N-terminal 10xHis tag (for purification)
Structural Features	Predicted transmembrane helices; conserved in Salmonella species .

Expression and Quality Control

Host System: E. coli .
Purity: >90% (SDS-PAGE) .
Storage: Lyophilized powder stable at -20°C/-80°C; reconstituted in Tris/PBS buffer with 6% trehalose .

Parameter	Specification
Expression Region	Full-length (1–100 aa)
Reconstitution	0.1–1.0 mg/mL in deionized water; 5–50% glycerol for long-term storage .
Activity Assays	Not explicitly reported; inferred from NDH-1 electron transfer assays .

Research Applications

Enzymatic Studies: Used to investigate NDH-1’s electron transfer mechanisms .
Antigen Production: Potential use in antibody generation for diagnostic tools .
Structural Biology: Aids in resolving membrane protein architectures .

Limitations and Knowledge Gaps

While recombinant NuoK is biochemically characterized, direct functional data (e.g., mutagenesis or activity assays) specific to this subunit remain sparse. Studies on homologous subunits (e.g., S. enterica NuoG/M/N) suggest that suppressor mutations in NDH-1 can rescue respiratory defects , but analogous experiments for NuoK are not documented.

Comparative Analysis With Related Subunits

Subunit	Domain	Functional Role	Mutation Impact
NuoK	Membrane-embedded	Structural stabilization; putative proton channel	Not studied
NuoG	Hydrophilic	Electron transfer via Fe-S clusters	Q297K mutation rescues quinone-deficient strains .
NuoM/N	Membrane-embedded	Proton translocation; quinone binding	A254S/A444E mutations enhance enzyme activity .

Product Specs

Form

Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.

Lead Time

Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.

Notes

Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.

Reconstitution

We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.

Shelf Life

The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

The tag type will be determined during the manufacturing process.

The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.

Synonyms

nuoK; SSPA0509; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-100

Protein Length

full length protein

Species

Salmonella paratyphi A (strain AKU_12601)

Target Names

nuoK

Target Protein Sequence

MIPLTHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG

Uniprot No.

B5BCM7

Target Background

Function

NDH-1 facilitates electron transport from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is believed to be the primary electron acceptor for the enzyme. It couples the redox reaction to proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy as a proton gradient.

Database Links

KEGG: sek:SSPA0509

Protein Families

Complex I subunit 4L family

Subcellular Location

Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Salmonella paratyphi A NADH-quinone oxidoreductase subunit K (nuoK)

Description

Definition and Biological Context

Amino Acid Sequence and Domains

Expression and Quality Control

Research Applications

Limitations and Knowledge Gaps

Comparative Analysis With Related Subunits

Product Specs

Target Background

Quick Inquiry

Category

Service