Recombinant Salmonella paratyphi A Nickel/cobalt efflux system rcnA (rcnA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Salmonella Paratyphi A Nickel/Cobalt Efflux System RcnA (rcnA) is a genetically engineered protein derived from the rcnA gene of Salmonella Paratyphi A. This transmembrane protein facilitates the efflux of nickel (Ni²⁺) and cobalt (Co²⁺) ions, mitigating metal toxicity in bacterial cells . The native rcnA gene (locus SPA2891) encodes a 274-amino acid polypeptide with a histidine-rich cytoplasmic loop critical for metal binding and transport .

Mechanism of Action

  • Efflux Function: Reduces intracellular Ni²⁺/Co²⁺ concentrations by exporting excess ions, as demonstrated by comparative nickel uptake assays in Escherichia coli .

    • Wild-type cells retain 20% less Ni²⁺ than rcnA mutants .

    • Overexpression of rcnA decreases intracellular Ni²⁺ by >80% .

Regulatory Network

The rcnA operon is regulated by the transcriptional repressor RcnR, which binds to the rcnA promoter in the absence of Ni²⁺/Co²⁺. Metal ions disrupt RcnR-DNA binding, derepressing rcnA expression .

Regulatory ComponentFunctionMetal Sensitivity
RcnRRepresses rcnA transcriptionInhibited by Ni²⁺/Co²⁺
RcnAMediates Ni²⁺/Co²⁺ effluxInduced by Ni²⁺/Co²⁺

Research Use

  • Metal Resistance Studies: Used to investigate bacterial adaptation to metal stress .

  • Protein Characterization: Available as recombinant proteins with His-tags for structural and functional assays .

Metal Homeostasis and Virulence

  • Link to Pathogenesis: Mutations in global regulators (e.g., SirA/BarA) downregulate virulence genes (e.g., SPI-1/SPI-4) and attenuate Salmonella virulence in murine models, suggesting a trade-off between metal resistance and pathogenicity .

  • Plasmid-Mediated Resistance: rcnA is identified in multidrug-resistant Salmonella plasmids, correlating with extended metal and antibiotic resistance .

Evolutionary and Ecological Significance

  • Conservation: Homologs of RcnA exist in E. coli (YohM), Ralstonia metallidurans (CnrCBA), and Helicobacter pylori (CznABC) .

  • Environmental Adaptation: Enables survival in metal-polluted environments, contributing to bacterial persistence in hosts and ecosystems .

Future Directions

  • Therapeutic Targeting: Inhibition of RcnA could sensitize Salmonella to host-derived metal toxicity .

  • Synthetic Biology: Engineering rcnA into bioremediation systems for Ni²⁺/Co²⁺ detoxification .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
rcnA; SPA2891; Nickel/cobalt efflux system RcnA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
rcnA
Target Protein Sequence
MGEFPTLLQQGNGWFFIPSAILLGILHGLEPGHSKTMMAAFIIAIKGTVKQAVMLGLAAT LSHTAIVWLIALGGMYLSRAFTAQSVEPWLQLISAIIILSTACWMFWRTWRGEQQWLAGN HHHDHDHDHDHDHDHHGHIHPEGATSKAYQDAHERAHAADIQRRFDGQTVTNGQILLFGL TGGLIPCPAAITVLLICIQLKAFTLGATMVLSFSLSLALTLVTVGVGAAISVQQAAKRWS GFSTLARRAPYFSSILIGLVGVYMGIHGYTGIMQ
Uniprot No.

Target Background

Function
Efflux system for nickel and cobalt.
Database Links

KEGG: spt:SPA2891

Protein Families
NiCoT transporter (TC 2.A.52) family, RcnA subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the rcnA system contribute to pathogenesis in Salmonella paratyphi A?

The rcnA efflux system contributes to Salmonella paratyphi A pathogenesis through several mechanisms:

  • Metal homeostasis: By regulating intracellular concentrations of nickel and cobalt, rcnA helps the bacterium maintain optimal cellular function during infection.

  • Resistance to host defenses: The host immune system often utilizes metal sequestration or metal toxicity as antimicrobial strategies. Efflux systems like rcnA allow Salmonella to counteract these host defense mechanisms.

  • Virulence regulation: Metal ions can function as cofactors for various virulence factors. The rcnA system may indirectly regulate virulence by controlling the availability of these metal cofactors.

  • Survival in macrophages: During intracellular infection within macrophages, Salmonella faces various metal stresses. Efflux systems provide protection against metal toxicity within this environment .

Research has shown that efflux systems work in concert with other cellular regulatory networks, with connections to cell envelope maintenance enzymes, stringent response activation, DNA housekeeping, respiration, and glutathione biosynthesis pathways, which collectively impact pathogen survival during infection .

How is rcnA genetically conserved across different Salmonella species and serovars?

The conservation of rcnA across Salmonella species reveals important evolutionary relationships:

Salmonella Species/SerovarrcnA Homology to S. paratyphi AKey Amino Acid DifferencesReference
S. paratyphi A (ATCC 9150)100% (reference)-
S. paratyphi BHigh (>95%)Variations in histidine-rich region
S. typhimurium>90%Differences in transmembrane domains
S. typhi>90%Minor variations in metal-binding sites
S. choleraesuis~85%Significant variations in C-terminal region

Phylogenetic studies using genome-wide SNP analysis place S. paratyphi A and S. choleraesuis in a different clade from S. typhi, indicating separate evolutionary paths despite their similar pathogenic capabilities .

What are the optimal methods for cloning and expressing recombinant Salmonella paratyphi A rcnA protein?

For successful cloning and expression of recombinant Salmonella paratyphi A rcnA protein, the following methodological approach is recommended:

Expression System Selection:
E. coli is the preferred expression host for recombinant rcnA due to its high yield and ease of manipulation. Among various strains, BL21(DE3) has shown optimal expression characteristics for membrane proteins like rcnA .

Vector Construction:

  • Amplify the rcnA gene (825 bp) from Salmonella paratyphi A genomic DNA using high-fidelity polymerase.

  • Design primers with appropriate restriction sites compatible with your expression vector.

  • For optimal expression, include a His-tag (preferably N-terminal) to facilitate purification.

  • Consider using vectors with tunable promoters (like pET series) to control expression levels.

Expression Conditions:

  • Temperature: Lower temperatures (16-25°C) often yield better results for membrane proteins like rcnA.

  • Induction: Use IPTG at 0.1-0.5 mM for pET system vectors.

  • Duration: Extended expression periods (overnight) at lower temperatures typically improve protein folding.

  • Media supplements: Consider adding trace amounts of nickel/cobalt (1-5 μM) to stabilize the protein.

Membrane Protein Solubilization:

  • Use mild detergents (DDM, LDAO, or C12E8) for extraction from membrane fractions.

  • Include glycerol (10-20%) in buffers to enhance protein stability.

  • Consider nanodiscs or liposomes for functional reconstitution studies .

This approach has yielded functional recombinant rcnA protein suitable for structural and functional analyses in multiple research settings.

How can researchers accurately measure rcnA-mediated efflux activity in laboratory settings?

Researchers can measure rcnA-mediated efflux activity using several complementary approaches:

1. Fluorescent Dye-Based Assays:

  • Resazurin dye (at 10 μg/ml) can be used to measure efflux activity indirectly.

  • Fluorescence measurements (excitation=544 nm, emission=590 nm) should be taken over 60 minutes.

  • Normalize readings using OD measurements of bacterial cell density.

  • Include PAβN (phenyl-arginine-β-naphthylamide) at 125 μg/ml as an efflux pump inhibitor to differentiate between efflux activity and membrane permeability effects .

2. Metal Ion Accumulation Assays:

  • Grow bacteria in minimal media supplemented with radioactive isotopes (⁶³Ni or ⁶⁰Co).

  • Measure intracellular metal accumulation using scintillation counting.

  • Compare wild-type strains with rcnA knockout mutants to quantify specific contribution of rcnA to efflux.

3. Growth Inhibition Assays:

  • Determine minimum inhibitory concentrations (MICs) for nickel and cobalt ions.

  • Compare wild-type with rcnA mutants under varying metal concentrations.

  • Use subinhibitory concentrations of metals (64 mg/l) and inhibitory concentrations (256 mg/l) to establish a dose-response relationship .

4. Gene Expression Analysis:

  • Quantify rcnA expression levels using qRT-PCR under different metal stress conditions.

  • Use RNA-Seq to identify co-regulated genes in the metal response network.

For all assays, include appropriate controls:

  • Negative control: rcnA deletion mutant

  • Positive control: rcnA overexpression strain

  • Technical control: known efflux pump inhibitor (PAβN at 125 μg/ml)

What genomic tools and methods are available for studying rcnA in the context of Salmonella paratyphi A epidemiology?

Several genomic tools and methods are available for studying rcnA in the epidemiological context of Salmonella paratyphi A:

1. Paratype Genotyping Framework:
The Paratype tool represents a significant advancement for Salmonella paratyphi A genomic epidemiology. This SNP-based genotyping scheme segregates S. paratyphi A into three primary clades, nine secondary clades, and 18 genotypes. Researchers can use Paratype to track rcnA variants across different geographical regions and temporal distributions .

2. Whole Genome Sequencing (WGS) Approaches:

  • Short-read Illumina sequencing provides high accuracy for SNP detection in rcnA.

  • Oxford Nanopore long-read technology helps resolve structural variations and can be used with Paratype.

  • Combine both approaches for comprehensive genomic analysis .

3. TraDIS-Xpress:
This genome-wide transposon mutagenesis technology identifies genes affecting efflux activity, including metal efflux systems like rcnA. The method involves:

  • Creating a transposon insertion library

  • Exposing the library to selective conditions (metal stress)

  • Sequencing to identify genes with differential insertion frequencies under stress conditions

  • Computational analysis to identify genetic interactions with efflux systems

4. PCR-Based Methods for Field Applications:
Multiplex PCR methods have been developed for rapid typing of Salmonella strains, which can be adapted to include rcnA-specific primers. This approach is particularly valuable for resource-limited settings .

5. Bioinformatic Analysis Tools:

  • ResFinder for identifying antimicrobial resistance genes that may interact with rcnA

  • PlasmidFinder for detecting plasmid sequences that might carry rcnA variants

  • SNP calling pipelines (GATK, FreeBayes) optimized for Salmonella genomes

These tools collectively enable comprehensive analysis of rcnA in relation to Salmonella paratyphi A epidemiology, evolution, and pathogenicity.

How does the rcnA system interact with other efflux systems and global regulators in Salmonella paratyphi A?

The rcnA system operates within a complex network of efflux systems and regulatory mechanisms in Salmonella paratyphi A:

Regulatory Network Integration:
The rcnA system is regulated by multiple layers of control:

  • Transcriptional Regulators:

    • MarA, SoxS, and RamA function as global regulators affecting multiple efflux systems

    • The AcrR local regulator negatively affects efflux activity (12.1 log fold difference in insertion numbers between control and stressed conditions)

    • The RpoS sigma factor influences expression of efflux systems through stress response pathways

  • Two-Component Systems:

    • PhoPQ system benefits efflux activity in Salmonella when exposed to efflux inhibitors

    • CpxAR system shows complex relationships with efflux regulation

    • These systems sense environmental cues and adjust efflux expression accordingly

  • Metabolic Integration:

    • Glutathione biosynthesis pathways influence efflux function

    • Respiratory chain components affect energetics of efflux systems

    • DNA repair mechanisms coordinate with efflux systems during stress responses

This network of interactions ensures proper coordination of metal homeostasis with other cellular functions, optimizing bacterial survival under varying environmental conditions. The connections between rcnA and other regulatory networks highlight the deep integration of metal efflux within the broader cellular physiology of Salmonella paratyphi A.

What is the role of rcnA in antimicrobial resistance mechanisms in Salmonella paratyphi A?

The rcnA efflux system contributes to antimicrobial resistance in Salmonella paratyphi A through several interconnected mechanisms:

Direct and Indirect Contributions to Antibiotic Resistance:
While rcnA primarily functions in metal efflux, research indicates it can contribute to antimicrobial resistance through:

  • Cross-substrate recognition: Metal efflux systems may recognize certain antibiotics as secondary substrates, particularly those with metal-chelating properties.

  • Physiological adaptation: Metal homeostasis influences bacterial physiology, which can indirectly alter susceptibility to antibiotics through changes in membrane permeability, biofilm formation, and metabolic states.

  • Regulatory overlap: The regulatory networks controlling rcnA expression often overlap with those controlling antibiotic resistance genes. TraDIS-Xpress data revealed connections between metal efflux systems and general stress response mechanisms that affect antibiotic tolerance .

Notably, while mutations in the AcrB efflux pump at position 717 have been linked to increased macrolide resistance in Salmonella Typhi and Paratyphi A from South Asia, such mutations were not identified in all outbreak sequences analyzed. This suggests variable contributions of different efflux components to the resistance phenotype depending on geographical and evolutionary context .

Therapeutic Implications:
Understanding rcnA's role in antimicrobial resistance has direct implications for therapeutic approaches:

  • Efflux pump inhibitors: Compounds like PAβN (at 125 μg/ml) can be used to potentiate antibiotic activity by blocking efflux systems.

  • Metal chelation therapy: Manipulating metal availability may disrupt bacterial homeostasis and potentially restore antibiotic susceptibility.

  • Combination therapies: Targeting both specific resistance mechanisms and efflux systems may provide more effective treatment options for resistant infections .

The World Health Organization has ranked fluoroquinolone-resistant Salmonellae as high-priority pathogens for the research and development of new antibiotics, highlighting the clinical importance of understanding and targeting efflux-mediated resistance mechanisms .

How can structural and functional analysis of rcnA contribute to novel therapeutic strategies against Salmonella paratyphi A?

Structural and functional analysis of rcnA offers significant potential for developing novel therapeutic strategies against Salmonella paratyphi A:

Structure-Based Drug Design Opportunities:
Detailed structural characterization of rcnA can reveal:

  • Metal binding sites: Identifying the precise amino acid residues involved in nickel and cobalt binding could enable the design of competitive inhibitors that block metal transport without triggering toxicity response pathways.

  • Transmembrane channel architecture: Understanding the conformational changes associated with metal transport could lead to the development of channel blockers that specifically target rcnA.

  • Protein-protein interaction interfaces: RcnA likely interacts with other membrane proteins and regulatory factors. These interaction sites represent potential targets for disrupting efflux system assembly or function .

Functional Insights for Therapeutic Development:
Functional studies of rcnA can inform novel approaches:

  • Metal-dependent antimicrobials: Understanding how rcnA handles different metals could lead to the development of metal-antibiotic conjugates designed to overwhelm or hijack the efflux system.

  • Regulatory circuit interventions: Targeting the regulatory pathways controlling rcnA expression could indirectly compromise metal homeostasis and bacterial survival.

  • Combination therapy strategies: Functional analysis can identify synergistic combinations of efflux inhibitors, metal chelators, and conventional antibiotics that more effectively eliminate Salmonella paratyphi A infections .

Vaccine Development Applications:
The characterization of rcnA also contributes to vaccine development efforts:

  • Subunit vaccine candidates: As a conserved membrane protein, rcnA could potentially serve as an antigen in subunit vaccines. Studies with other outer membrane proteins of Salmonella paratyphi A have demonstrated significant immunoprotection, with protection rates ranging from 70-95% in mouse models .

  • Live attenuated vaccine platforms: Understanding rcnA's role in metal homeostasis could inform the rational design of attenuated vaccine strains with modified metal efflux capabilities. Several attenuated Salmonella paratyphi A strains have already been developed by targeting genes in various pathways (phoPQ, guaBA, clpX, and sptP), and similar approaches could be applied to rcnA .

  • Adjuvant properties: Metal homeostasis proteins like rcnA can influence immune response pathways, potentially offering adjuvant properties when incorporated into vaccine formulations.

These structure-function approaches to rcnA could significantly advance the development of much-needed countermeasures against Salmonella paratyphi A, which causes an estimated 3.4 million infections annually worldwide .

How are recent genomic surveillance efforts enhancing our understanding of rcnA diversity in global Salmonella paratyphi A populations?

Recent genomic surveillance efforts have significantly expanded our understanding of rcnA diversity within global Salmonella paratyphi A populations:

Global Genomic Database Development:
The development of comprehensive genomic databases has revolutionized Salmonella paratyphi A surveillance:

  • Geographical representation: Current databases include isolates from 37 countries, spanning the period from 1917-2019, providing unprecedented insights into the global distribution of rcnA variants .

  • Paratype implementation: The application of the Paratype genotyping tool has enabled systematic classification of S. paratyphi A into defined genetic lineages, facilitating tracking of specific rcnA variants across different geographical regions and time periods .

  • Integration with clinical data: Linking genomic data with clinical outcomes has revealed associations between specific rcnA variants and disease severity or treatment response .

Evolutionary Insights:
Genomic surveillance has revealed important evolutionary patterns in rcnA:

  • Clade-specific signatures: Analysis of 1,379 Salmonella Paratyphi A isolates identified distinct genetic signatures across different clades, including variations in efflux pump genes like rcnA .

  • Selection pressure evidence: Differential nucleotide substitution patterns suggest that human adaptation has exerted specific selection pressures on metal homeostasis systems, including rcnA .

  • Horizontal gene transfer assessment: Surveillance data has identified instances of plasmid-associated metal resistance genes that may complement or interact with chromosomal rcnA systems .

Practical Applications:
These surveillance efforts have direct practical applications:

  • Outbreak tracking: During the 2018-2019 enteric fever outbreak in Vadodara, India, whole-genome sequencing identified specific genotypes (primarily genotype 2.3) associated with the outbreak, allowing precise tracking of transmission patterns .

  • Antimicrobial resistance monitoring: Genomic surveillance has revealed the emergence and spread of antimicrobial resistance determinants associated with efflux systems, guiding treatment recommendations .

  • Vaccine development guidance: Understanding the global diversity of rcnA and other membrane proteins informs the development of broadly protective vaccines against Salmonella paratyphi A .

As these genomic surveillance efforts continue to expand, our understanding of rcnA diversity and its implications for Salmonella paratyphi A pathogenesis, transmission, and control will continue to improve, enabling more targeted and effective public health interventions.

What are the methodological challenges in studying metal efflux systems like rcnA in intracellular pathogens?

Studying metal efflux systems like rcnA in intracellular pathogens presents several significant methodological challenges:

Challenges in Cellular Models:

  • Intracellular environment replication: Creating experimental conditions that accurately mimic the intracellular environment where Salmonella paratyphi A naturally exists is difficult. Traditional in vitro systems fail to reproduce the complex metal availability patterns found within host cells .

  • Host-pathogen interface dynamics: The dynamic nature of host-pathogen interactions means metal concentrations and availability continuously change during infection. Static experimental systems cannot capture these temporal dynamics .

  • Organoid model limitations: While gallbladder organoids have been developed as improved models for Salmonella infection studies, these systems still present challenges in maintaining long-term infections and accurately measuring intracellular metal concentrations .

Technical Measurement Limitations:

Genetic Manipulation Barriers:

  • Functional redundancy: Multiple efflux systems often exhibit functional overlap, making it difficult to isolate the specific contribution of rcnA through single-gene knockout approaches .

  • Regulatory network complexity: The complex regulatory networks controlling rcnA expression involve multiple global regulators (MarA, SoxS, RamA) and two-component systems (PhoPQ, CpxAR), creating significant experimental complexity .

  • Essential gene considerations: Some components of metal homeostasis may be essential for bacterial survival, limiting the applicability of conventional knockout approaches .

Innovative Solutions:

Addressing these methodological challenges will be essential for advancing our understanding of rcnA and other metal efflux systems in Salmonella paratyphi A and related intracellular pathogens.

How might cross-disciplinary approaches advance our understanding of rcnA function in Salmonella paratyphi A pathogenesis?

Cross-disciplinary approaches offer powerful opportunities to advance our understanding of rcnA function in Salmonella paratyphi A pathogenesis:

Integration of Structural Biology and Computational Approaches:

  • Cryo-electron microscopy: Advanced structural determination techniques can reveal the three-dimensional architecture of rcnA in its native membrane environment, providing insights into metal binding sites and conformational changes during transport.

  • Molecular dynamics simulations: Computational modeling of rcnA's interactions with metals, membrane lipids, and potential inhibitors can predict functional properties and guide experimental design.

  • Machine learning applications: AI-based approaches can identify patterns in genomic data that correlate specific rcnA variants with clinical outcomes or environmental adaptations .

Systems Biology and Network Science:

Immunology and Host-Pathogen Interface Studies:

  • Single-cell analysis: Examining host cell responses to Salmonella with varying rcnA expression levels can reveal how metal homeostasis affects host defense mechanisms.

  • Nutritional immunity mechanisms: Investigating how host metal sequestration strategies interact with bacterial efflux systems provides insights into evolutionary arms races.

  • Extracellular vesicle analysis: Studying how membrane proteins like rcnA are incorporated into bacterial outer membrane vesicles may reveal novel pathogenesis mechanisms and immune modulation strategies .

Engineering and Synthetic Biology Applications:

  • Designer efflux systems: Creating modified versions of rcnA with altered metal specificity or regulatory properties can provide functional insights while developing potential biotechnological applications.

  • Biosensor development: Utilizing rcnA-based systems to create sensitive metal detection platforms for environmental or clinical applications.

  • Synthetic biology circuits: Incorporating rcnA into engineered genetic circuits could enable the development of programmable cellular systems for therapeutic or diagnostic purposes .

Clinical and Epidemiological Integration:

  • Genomic epidemiology: Mapping rcnA variants across clinical isolates using tools like Paratype can reveal associations with disease outcomes or geographical distributions.

  • Pharmacological targeting: Collaborative efforts between medicinal chemists and microbiologists can develop specific inhibitors of rcnA function as potential therapeutics.

  • Vaccine development: Immunologists and structural biologists can collaborate to identify rcnA epitopes that might serve as effective vaccine components .

These cross-disciplinary approaches collectively offer a more comprehensive understanding of rcnA function than could be achieved through any single disciplinary perspective, potentially accelerating the development of novel interventions against Salmonella paratyphi A infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.