Recombinant Salmonella paratyphi A Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Introduction

ArnE is a membrane protein involved in translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol), a lipid-linked sugar essential for modifying lipopolysaccharides (LPS) in Gram-negative bacteria . In Salmonella paratyphi A, recombinant ArnE enables researchers to investigate mechanisms of antibiotic resistance and immune evasion, while supporting conjugate vaccine development .

Protein Structure and Gene Information

  • Gene Locus: SPA0561 in S. paratyphi A (strain ATCC 9150) .

  • Domains: Contains an EamA-like transporter domain for lipid flipping .

Table 1: Key Features of Recombinant ArnE

PropertyDetail
UniProt IDQ5PNA9
Molecular FunctionFlippase for α-L-Ara4N-phosphoundecaprenol translocation
Expression SystemRecombinant E. coli or Salmonella strains
Storage ConditionsTris-based buffer with 50% glycerol; stable at -20°C to -80°C

Biological Function and Mechanism

ArnE facilitates the "flipping" of α-L-Ara4N-phosphoundecaprenol from the cytoplasmic to the periplasmic side of the inner membrane, enabling LPS modification. This process:

  • Enhances bacterial resistance to cationic antimicrobial peptides (CAMPs) .

  • Modulates host immune responses by altering O-antigen presentation .

Recombinant Production

Recombinant ArnE is produced using engineered Salmonella or E. coli strains, optimized for high-yield expression:

  • Purity: >90% via affinity chromatography .

  • Applications: Antibody production, ELISA, and functional assays .

Vaccine Development

  • Conjugate Vaccines: Recombinant ArnE supports O-linked glycosylation systems for attaching O-polysaccharides to carrier proteins, enhancing immunogenicity .

  • Immune Response: In mice, ArnE-based vaccines elicited IgG1 antibodies and bactericidal activity against S. paratyphi A .

Pathogenesis Studies

  • Oxidative Stress: S. paratyphi A infection increases oxidative stress in C. elegans, mediated by MAPK and insulin pathways .

  • Virulence: ArnE’s role in LPS biosynthesis impacts bacterial colonization and thermotolerance .

Table 2: Key Studies Involving ArnE

Study FocusFindingsSource
Conjugate Vaccine Efficacy100 µg doses of outer membrane proteins (e.g., LamB, PagC) achieved 95% protection in mice .
Genetic Knockout EffectsarnE deletion reduces LPS modification, increasing susceptibility to polymyxin B .
Host InteractionS. paratyphi A infection shortens C. elegans lifespan via daf-2/daf-16 pathways .

Challenges and Future Directions

  • Antigen Specificity: Cross-reactivity with other Salmonella serovars remains unresolved .

  • Clinical Translation: Limited human trials for ArnE-based vaccines necessitate further validation .

  • Synthetic Biology: Optimizing glycosylation systems for scalable conjugate vaccine production .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it for your product.
Synonyms
arnE; SSPA0525; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
arnE
Target Protein Sequence
MIGIVLVLASLLSVGGQLCQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQT LPVGIAYPMLSLNFVWVTLAAWKIWHEQVLPRHWLGVALIISGIIILGSAA
Uniprot No.

Target Background

Function
ArnE facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links

KEGG: sek:SSPA0525

Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ArnE and what is its primary function in Salmonella paratyphi A?

ArnE is a subunit of the undecaprenyl phosphate-aminoarabinose flippase complex, responsible for translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol from the cytoplasmic to the periplasmic side of the inner membrane in Gram-negative bacteria . In Salmonella paratyphi A, as in other Salmonella species, ArnE (formerly called PmrL) functions in conjunction with ArnF (formerly PmrM) to facilitate the transport of undecaprenyl phosphate-α-L-Ara4N across the inner membrane . This transport process is a crucial step in the modification of lipid A with the L-Ara4N moiety, which is required for resistance to polymyxin and cationic antimicrobial peptides.

How is ArnE genetically organized in the bacterial genome?

ArnE is encoded by the arnE gene (formerly pmrL), which is part of a seven-gene operon originally designated as pmrHFIJKLM and now renamed to reflect the involvement of these genes in L-Ara4N modification of lipid A . This operon is co-transcribed under the control of the transcription factor PmrA. The genetic organization is highly conserved across various Gram-negative species including Salmonella typhimurium and Escherichia coli, indicating the evolutionary importance of this pathway for bacterial survival under specific stress conditions.

What experimental evidence supports ArnE's role as a flippase subunit?

The role of ArnE as a flippase subunit was established through several lines of experimental evidence. Research demonstrated that strains with mutations in pmrL (arnE) and pmrM (arnF) exhibited significantly reduced transport of undecaprenyl phosphate-α-L-Ara4N across the inner membrane . Specifically, N-hydroxysulfosuccinimidobiotin labeling experiments showed that the transport was impaired in these mutants, while the function of ArnT (the transferase that attaches L-Ara4N to lipid A) remained intact. These findings implicated ArnE and ArnF as components of the flippase machinery rather than being directly involved in the transferase activity.

What protein domains characterize the ArnE protein?

ArnE contains domains characteristic of the EamA-like transporter family . This protein family includes various membrane transporters with similar structural organizations. Sequence analysis of ArnE from Pseudomonas aeruginosa PA7 reveals a predominantly hydrophobic protein consistent with its membrane-embedded location, containing multiple transmembrane segments that form the channel through which the lipid-linked substrate is transported across the membrane bilayer .

What is the molecular mechanism of L-Ara4N translocation by the ArnE/ArnF complex?

The precise molecular mechanism of L-Ara4N translocation by the ArnE/ArnF complex remains under investigation, but current models suggest that these proteins form a heterodimeric complex that creates a protected pathway for the hydrophilic head group of undecaprenyl phosphate-α-L-Ara4N to cross the hydrophobic membrane environment . The translocation likely involves conformational changes in the protein complex that allow the substrate to move from the inner to the outer leaflet of the membrane while keeping the polar portions shielded from the hydrophobic membrane interior.

The process is energetically unfavorable without protein assistance, as it requires moving the charged phosphate-sugar moiety through the hydrophobic membrane core. ArnE and ArnF are believed to work together to lower this energy barrier, potentially using energy from proton gradients or other cellular energy sources to drive the translocation process, although the exact energy coupling mechanism remains to be elucidated.

How do mutations in arnE affect bacterial resistance to antimicrobial peptides?

Mutations in arnE significantly impact bacterial resistance to antimicrobial peptides by disrupting the translocation of undecaprenyl phosphate-α-L-Ara4N to the periplasmic side of the membrane . This disruption prevents the subsequent transfer of L-Ara4N to lipid A by ArnT, resulting in unmodified lipid A that remains susceptible to cationic antimicrobial peptides such as polymyxin. Studies in Salmonella have shown that bacteria with arnE mutations exhibit significantly reduced minimum inhibitory concentrations (MICs) for polymyxin and other cationic antimicrobial peptides compared to wild-type strains.

The relationship between arnE mutations and antimicrobial resistance is particularly significant in the context of adaptive laboratory evolution experiments, where bacteria grown under stress conditions such as acid exposure can develop cross-resistance to antibiotics . This suggests that environmental stressors can select for mutations affecting the ArnE/ArnF flippase complex, potentially contributing to the emergence of multidrug-resistant bacterial strains.

What structural differences exist between ArnE in different bacterial species?

While the core function of ArnE appears conserved across Gram-negative bacteria, structural variations exist between species that may reflect adaptations to different environmental niches or host-specific pressures. Comparing the amino acid sequences of ArnE from Salmonella paratyphi A with those from other species such as Pseudomonas aeruginosa reveals both conserved domains essential for function and variable regions that may confer species-specific properties .

For instance, the ArnE protein from Pseudomonas aeruginosa PA7 consists of 100 amino acids forming a predominantly hydrophobic membrane protein . The conservation of key functional domains across species suggests evolutionary pressure to maintain the core flippase function, while variations in non-essential regions may reflect species-specific adaptations or neutral evolutionary drift.

How does environmental pH affect ArnE expression and function?

Environmental pH significantly influences ArnE expression through the PmrA/PmrB two-component regulatory system . Under acidic conditions, similar to those encountered in the food industry where organic acids like acetic acid are used for fermentation and flavoring, the PmrB sensor kinase activates PmrA through phosphorylation. Phosphorylated PmrA then upregulates the transcription of the arn operon, including arnE.

Adaptive laboratory evolution experiments with Salmonella enterica exposed to acetic acid stress have demonstrated increased resistance to antimicrobial compounds over time, suggesting that acid adaptation involves changes in membrane modification pathways including the ArnE-mediated lipid A modification system . After approximately 30 days of adaptation to increasing concentrations of acetic acid, Salmonella strains showed elevated minimum inhibitory concentrations, indicating significant physiological adaptations potentially involving ArnE-dependent pathways.

What are the optimal methods for purifying recombinant ArnE for structural studies?

Purification of recombinant ArnE presents significant challenges due to its hydrophobic nature and membrane localization. The most successful approaches typically involve:

  • Expression System Selection: Using specialized expression systems designed for membrane proteins, such as C41(DE3) or C43(DE3) E. coli strains that are tolerant to membrane protein overexpression.

  • Fusion Tag Optimization: Incorporating solubility-enhancing fusion tags such as maltose-binding protein (MBP) or small ubiquitin-like modifier (SUMO) at the N-terminus to improve expression and solubility.

  • Detergent Screening: Systematic testing of multiple detergents (e.g., n-dodecyl-β-D-maltoside, lauryl maltose neopentyl glycol) to identify optimal conditions for extraction from membranes while maintaining protein stability and activity.

  • Chromatography Techniques: Sequential purification using affinity chromatography (leveraging fusion tags), followed by size exclusion chromatography to obtain homogeneous protein preparations suitable for structural studies.

The purification protocol must be optimized for each specific experimental goal, with particular attention to maintaining the native conformation of the protein throughout the purification process.

What genetic tools are available for studying arnE function in vivo?

Several genetic approaches have proven valuable for investigating arnE function in bacterial systems:

  • Gene Deletion/Knockouts: Creating precise gene deletions using lambda Red recombinase-based systems or CRISPR-Cas9 technologies allows researchers to assess the phenotypic consequences of arnE loss.

  • Complementation Studies: Reintroducing wild-type or mutant arnE variants on plasmids into knockout strains enables structure-function analyses and identification of critical residues.

  • Fluorescent Protein Fusions: Creating translational fusions with fluorescent proteins such as GFP allows visualization of ArnE localization and dynamics in living cells, though care must be taken to ensure fusion proteins retain functionality.

  • Controllable Expression Systems: Utilizing inducible promoters (e.g., arabinose or tetracycline-responsive) to modulate arnE expression levels, facilitating studies of dosage effects on antimicrobial resistance.

  • Adaptive Laboratory Evolution: Subjecting bacterial populations to selective pressures such as acid stress or sub-inhibitory antimicrobial concentrations can reveal adaptive mutations affecting arnE function .

How can researchers measure flippase activity in vitro?

Measuring flippase activity presents significant technical challenges due to the membrane environment and the nature of the substrates. Several approaches have been developed:

  • Fluorescent Substrate Analogs: Synthesizing fluorescently labeled analogs of undecaprenyl phosphate-α-L-Ara4N that change spectral properties upon translocation between membrane leaflets.

  • Reconstituted Proteoliposome Assays: Incorporating purified ArnE/ArnF into artificial liposomes with defined lipid compositions, then monitoring substrate translocation across the membrane bilayer.

  • Accessibility Assays: Using membrane-impermeable reagents that react with the substrate only when it is exposed on the outer leaflet of the membrane, allowing quantification of translocation rates.

  • Mass Spectrometry Approaches: Developing sensitive MS methods to detect and quantify modified lipids in different membrane compartments following reconstitution of the flippase system.

Each of these methods requires careful controls to account for spontaneous (non-protein-mediated) flip-flop of lipids between membrane leaflets, which can confound measurements of true flippase activity.

Table 1: Comparative Analysis of ArnE Molecular Characteristics Across Bacterial Species

SpeciesProtein IDLength (aa)Molecular Weight (kDa)Isoelectric PointKey Structural Features
Pseudomonas aeruginosa PA7A6V1N7100~11~9.5EamA-like transporter family domain
Salmonella paratyphi AMBS7084743108*~12*~9.6*Multiple transmembrane segments
Salmonella typhimuriumN/A107*~11.8*~9.4*Forms complex with ArnF
Escherichia coliN/A106*~11.7*~9.3*Similar operon structure to Salmonella

*Values estimated based on typical characteristics of homologous proteins; exact values may vary.

Table 2: Effect of Environmental Conditions on ArnE-Mediated Resistance in Salmonella

Environmental ConditionEffect on ArnE ExpressionEffect on Antimicrobial ResistanceProposed Mechanism
Acidic pH (e.g., acetic acid)IncreasedEnhanced resistance to polymyxinActivation of PmrA/PmrB system leading to upregulation of arn operon
Divalent cation limitationIncreasedEnhanced resistance to cationic antimicrobial peptidesFe³⁺-PmrA activation pathway inducing arnE transcription
High Mg²⁺ concentrationDecreasedReduced resistance to polymyxinRepression of PhoPQ system that normally activates PmrA/PmrB
Adaptive evolution in acid stressProgressively increasedIncreasing MIC for antimicrobials over timeSelection for regulatory mutations enhancing arnE expression

Table 3: Experimental Systems for Studying ArnE Function

Experimental ApproachAdvantagesLimitationsKey Applications
Recombinant expression in E. coliWell-established protocols, high yield potentialMay not reproduce native regulation, potential toxicityProtein purification, structural studies
Genetic modification in SalmonellaNative genetic context, physiologically relevantMore challenging genetic manipulation than E. coliIn vivo functional studies, resistance phenotyping
Adaptive laboratory evolutionReveals natural adaptive pathways, identifies relevant mutationsTime-consuming, may yield multiple complex changesUnderstanding evolutionary trajectories, resistance mechanisms
Liposome reconstitutionDefined system, direct measurement of flippase activityArtificial environment, technical complexityBiochemical mechanism studies, inhibitor screening

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.