Recombinant Salmonella paratyphi A Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Salmonella Paratyphi A Probable Intracellular Septation Protein A (YciB) is a genetically engineered protein produced for studying bacterial cell division mechanisms and host-pathogen interactions. YciB is implicated in intracellular septation, a critical step in bacterial cell division, though its precise role in Salmonella Paratyphi A remains under investigation. This protein has garnered interest for its potential applications in diagnostics and vaccine development.

Recombinant Production

YciB is expressed in heterologous systems (e.g., E. coli) with tags for purification. Commercial formulations are stored in Tris-based buffer with 50% glycerol at -20°C to ensure stability .

Diagnostic Tools

Recombinant YciB is used in ELISA kits for antibody detection in Salmonella infections.

  • Sensitivity: Detects antibodies at concentrations as low as 1 ng/mL.

  • Specificity: Cross-reactivity tests show minimal interference with other Salmonella serovars .

Immunological Studies

  • Antigenicity: YciB elicits robust IgG and IgA responses in murine models.

  • Vaccine Development: Explored as a component of multi-epitope vaccines targeting enteric fever .

Challenges and Future Directions

  • Functional ambiguity: Mechanistic studies on YciB’s role in septation are needed.

  • Clinical relevance: Correlation between YciB expression and disease progression remains unvalidated.

  • Therapeutic potential: Engineered YciB mutants could enhance vaccine efficacy against enteric fever .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please specify it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
yciB; SSPA1061; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKIEKMALITFVLVAV FGGLTLFFHNDEFIKWKVTVIYALFAGALLISQWVMKKPLIQRMLGKELALPQQVWSKLN LAWALFFIACGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintenance of cell envelope integrity, and membrane homeostasis.
Database Links

KEGG: sek:SSPA1061

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salmonella enterica serovar Paratyphi A and why is it a focus of vaccine research?

Salmonella Paratyphi A is one of the primary causative agents of paratyphoid fever, with an increasing global incidence. Unlike Salmonella Typhi, which produces the immunogenic Vi capsular polysaccharide, S. Paratyphi A naturally lacks this component . Currently licensed vaccines for typhoid fever (live Ty21a vaccine, Vi subunit vaccine, and Vi-conjugate vaccine) provide inadequate cross-immunoprotection against paratyphoid fever . This has driven significant research into developing bivalent vaccines that could provide protection against both pathogens. Recent approaches include engineering S. Paratyphi A strains to express Vi polysaccharide by integrating the viaB locus, which contains 10 genes responsible for Vi biosynthesis . When combined with virulence-attenuating deletions in genes like htrA and phoPQ, these engineered strains show promise as vaccine candidates in mouse models .

What is the function of intracellular septation protein A (yciB) in bacterial cell biology?

YciB (Probable intracellular septation protein A) is a membrane protein involved in bacterial cell division and cellular envelope integrity. During septation, it contributes to proper membrane invagination and peptidoglycan synthesis at the division site. As a membrane protein, YciB likely interacts with components of both the cytoplasmic membrane and the cell wall synthesis machinery.

Methodologically, characterizing YciB function requires:

  • Generation of deletion mutants using allelic exchange techniques similar to those described for virulence gene modifications in S. Paratyphi A

  • Fluorescent protein fusions to visualize localization during cell division

  • Protein-protein interaction studies to identify binding partners

  • Phenotypic characterization of mutants under various growth conditions

  • Complementation analysis with wild-type and mutant alleles

How does the Type III Secretion System (T3SS) contribute to Salmonella pathogenesis?

The Type III Secretion System (T3SS) is crucial for Salmonella virulence and functions as a molecular needle that injects effector proteins directly into host cells . Research has demonstrated that the T3SS machinery itself directly modulates the extent to which bacteria escape from phagosomes, independent of translocated effectors .

The T3SS includes:

  • A needle complex spanning bacterial membranes

  • Translocon components (like SipC in Salmonella) that form pores in host cell membranes

  • Regulatory proteins controlling expression and assembly

  • Chaperones that bind effectors in the bacterial cytoplasm

Importantly, the translocon protein component (Salmonella SipC) has been shown to determine bacterial intracellular fate within both epithelial cells and macrophages . This finding emerged from research using an innovative approach where a functional Shigella T3SS was introduced into laboratory E. coli strains, demonstrating that the T3SS apparatus itself can mediate vacuole lysis .

What genetic engineering strategies are most effective for expressing recombinant proteins in S. Paratyphi A?

Based on successful approaches for engineering S. Paratyphi A, the following methodologies are recommended:

Table 1: Comparative Genetic Engineering Approaches for S. Paratyphi A

StrategyAdvantagesLimitationsExample Application
Chromosomal integrationStable maintenance, controlled copy number, no antibiotic required for maintenanceLower expression than high-copy plasmids, more time-consumingviaB locus integration for Vi polysaccharide production
Suicide plasmid-based allelic exchangePrecise genetic modification, marker-free outcomes possibleRequires counter-selection, two recombination eventsDeletion of htrA and phoPQ virulence loci
IPTG-inducible expression systemsControlled expression timing, adjustable levelsPotential leaky expression, metabolic burdenSimilar to mT3_E. coli system with inducible virB
Lambda Red recombineeringRapid construction of mutants, efficient for large-scale studiesRequires special strains, potential off-target effectsGeneration of gene deletion libraries

For stable expression of membrane proteins like YciB, chromosomal integration using suicide plasmids containing:

  • The yciB gene with native or inducible promoter

  • Flanking homology regions for targeted integration

  • Counter-selectable markers (like sacB) for selection of double recombinants

  • Antibiotic resistance for initial selection

This approach has been successfully used for integrating the viaB locus into S. Paratyphi A CMCC 50093, with stable maintenance through more than 200 passages .

What challenges exist in purifying membrane proteins like YciB from Salmonella, and how can they be addressed?

Purification of membrane proteins like YciB presents specific challenges:

Table 2: Membrane Protein Purification Challenges and Solutions

ChallengeImpactMethodological Solution
HydrophobicityPoor solubility in aqueous buffersUse of appropriate detergents (DDM, LDAO, Triton X-100)
Low natural abundanceDifficult detectionRecombinant expression with affinity tags
Conformational stabilityLoss of function during extractionMild solubilization conditions, stabilizing additives
HeterogeneityMultiple oligomeric statesSize-exclusion chromatography, analytical ultracentrifugation
Host cell toxicityPoor expression yieldsInducible promoters, low-temperature induction

A comprehensive purification protocol would include:

  • Optimization of expression conditions (temperature, induction time, media composition)

  • Membrane fraction isolation using differential centrifugation

  • Solubilization screening to identify optimal detergent conditions

  • Affinity chromatography using N- or C-terminal tags (His, FLAG, etc.)

  • Secondary purification by ion exchange or size exclusion chromatography

  • Functional validation using appropriate activity assays

How can researchers effectively study YciB-protein interactions in S. Paratyphi A?

Studying protein-protein interactions involving membrane proteins requires specialized approaches:

Table 3: Methods for Studying YciB Protein Interactions

MethodApplicationAdvantagesLimitations
Bacterial two-hybridIn vivo binary interactionsDetects interactions in bacterial environmentMay miss membrane interactions
Co-immunoprecipitationProtein complexes in native statePreserves physiologically relevant interactionsRequires high-quality antibodies
Cross-linking mass spectrometrySpatial relationship between proteinsDetects transient interactionsComplex data analysis
FRET/BRETIn vivo dynamicsReal-time monitoring, spatial resolutionRequires fluorescent protein fusions
Split-GFP complementationIn vivo binary interactionsVisual confirmation in live cellsPotential interference with function

For YciB specifically, researchers should:

  • Generate fusion constructs with appropriate epitope tags or fluorescent proteins

  • Validate function of tagged proteins (complementation of deletion phenotypes)

  • Perform preliminary localization studies to identify potential interaction sites

  • Use proximity-based labeling (BioID, APEX) to identify neighboring proteins

  • Confirm key interactions with multiple orthogonal methods

  • Assess interaction dynamics under different environmental conditions that affect Salmonella virulence, such as oxygen "sweet spots" that trigger virulence systems

How does deletion or overexpression of YciB affect S. Paratyphi A virulence and host cell interactions?

Investigating YciB's role in virulence requires systematic manipulation and phenotypic characterization:

Table 4: Experimental Design for YciB Virulence Studies

Genetic ConstructPurposeKey AssaysExpected Observations
ΔyciBLoss-of-functionInvasion efficiency, intracellular survivalPotential membrane integrity defects, altered invasion
ΔyciB + pYciBComplementationSame as aboveRestoration of wild-type phenotype
YciB-overexpressionGain-of-functionSame as above, plus membrane integrityPotential division defects, altered envelope properties
YciB point mutationsStructure-functionSame as aboveIdentification of critical functional residues

The approach should include:

  • Construction of mutants using techniques similar to those used for htrA and phoPQ deletion in S. Paratyphi A

  • In vitro infection models using epithelial cells and macrophages

  • Comparison of phagosomal escape rates using the digitonin permeabilization and fluorescent antibody labeling method described for studying T3SS function

  • Assessment of T3SS function in YciB mutants, given the importance of this system for Salmonella virulence

  • Evaluation of mutant survival under relevant stress conditions, including those encountered during infection

What is the relationship between YciB function and Type III Secretion System (T3SS) efficiency?

Given the importance of T3SS in Salmonella pathogenesis , potential functional relationships with YciB deserve investigation:

  • T3SS component localization: Determine if YciB affects proper localization of injectisome components using immunofluorescence or fluorescent protein fusions

  • T3SS assembly kinetics: Compare assembly rates between wild-type and ΔyciB strains

  • Effector translocation: Measure delivery of reporter-tagged effectors into host cells

  • Host cell invasion: Compare invasion rates in epithelial cells using gentamicin protection assays

  • Membrane integrity: Assess if YciB deletion affects membrane properties critical for T3SS function

Since environmental parameters like oxygen levels act as signals for Salmonella to turn virulence systems on and off , researchers should examine if YciB participates in sensing or responding to these signals, potentially affecting T3SS expression or function.

How do genomic variations in the yciB gene correlate with clinical outcomes of S. Paratyphi A infections?

This research direction would leverage genomic epidemiology approaches similar to those used in the development of Paratype, a genotyping tool for S. Paratyphi A .

Table 5: Framework for Analyzing YciB Genomic Variations

Analysis LevelApproachTools/MethodsExpected Outcomes
Sequence variationWGS of clinical isolatesSNP identification, variant callingYciB allelic variants
Population structurePhylogenetic analysisParatype genotyping framework Association with specific clades/genotypes
Clinical correlationStatistical associationCase data linkage, multivariate analysisIdentification of high-risk variants
Functional validationSite-directed mutagenesisRecombinant protein expression, phenotypingMechanistic understanding of variants

Implementation would require:

  • Collection and whole-genome sequencing of diverse clinical S. Paratyphi A isolates

  • Analysis using the Paratype SNP-based genotyping scheme that segregates S. Paratyphi A into three primary, nine secondary clades, and 18 genotypes

  • Specific focus on yciB variations and their correlation with antimicrobial resistance markers

  • In vitro characterization of identified variations through site-directed mutagenesis

  • Potential incorporation of yciB sequence data into expanded genotyping schemes

Could YciB serve as a target for novel antimicrobial development against S. Paratyphi A?

Evaluating YciB as a potential antimicrobial target requires systematic assessment:

Table 6: Antimicrobial Target Evaluation Criteria for YciB

CriterionAssessment MethodDesired OutcomeResearch Implications
EssentialityConditional knockdown, high-throughput screeningGrowth inhibition upon depletionValidation as critical protein
ConservationBioinformatic analysis across pathogensHigh conservation in pathogens, low in commensalsPotential broad-spectrum application
DruggabilityStructural analysis, binding pocket identificationPresence of targetable sitesFeasibility for small molecule development
Resistance potentialSerial passage, mutation rate analysisLow frequency of resistanceSustainability as therapeutic target
In vivo efficacyAnimal infection modelsAttenuation of YciB mutantsTranslation potential to clinical applications

Research approaches should include:

  • Determination of YciB structure through X-ray crystallography or cryo-EM

  • High-throughput screening campaigns to identify inhibitory compounds

  • Medicinal chemistry optimization of hit compounds

  • Assessment of effects on bacterial growth, division, and virulence

  • Evaluation of synergy with existing antibiotics

How might recombinant YciB be incorporated into vaccine development strategies against S. Paratyphi A?

Building on the successful approach of creating a Vi-producing attenuated S. Paratyphi A vaccine candidate , YciB could be explored as a vaccine component:

Table 7: YciB-Based Vaccine Development Strategies

ApproachMethodologyAdvantagesChallenges
Subunit vaccinePurified recombinant YciB with adjuvantsDefined composition, safetyMaintaining conformational epitopes
DNA vaccinePlasmid encoding yciBCell-mediated immunity, stabilityDelivery efficiency
Live attenuated vectorYciB expression in attenuated strainMucosal immunity, cellular responsesGenetic stability
Epitope vaccineYciB-derived peptidesSafety, focused responseLimited epitope coverage
YciB as carrier proteinYciB conjugated to polysaccharidesEnhanced immunogenicityComplex manufacturing

Research directions should include:

  • Immunogenicity screening of YciB epitopes in animal models

  • Combination with established approaches like Vi polysaccharide expression

  • Evaluation of htrA and phoPQ deletions (used in existing vaccine candidates ) in combination with YciB-based strategies

  • Assessment of both humoral and cell-mediated immune responses

  • Protection studies against wild-type challenge with both S. Paratyphi A and S. Typhi, similar to those described for the Vi-producing vaccine candidate

How do environmental conditions that Salmonella encounters during infection affect YciB expression and function?

This research question connects to findings about Salmonella's ability to sense environmental parameters that signal its location in the intestine, enabling precise timing of virulence activation .

Table 8: Environmental Factors Affecting Salmonella Virulence and Potential YciB Responses

Environmental FactorDetection MethodPhysiological RelevancePotential YciB Connection
Oxygen levelsMicroaerobic culturing, oxygen-sensitive reporters"Sweet spot" oxygen levels trigger virulence Membrane protein function/localization
pHGrowth in buffered media at various pHGastric acidity, phagosomal acidificationProton gradient effects on membrane proteins
Salt concentrationMedia with varying osmolarityIntestinal osmotic conditionsMembrane tension and septation dynamics
Bile saltsGrowth in presence of bile acidsSmall intestine environmentMembrane integrity challenge
Fatty acidsExposure to intestinal fatty acidsHost-derived antimicrobial factorsMembrane composition adaptation

Experimental approaches should:

  • Generate reporter fusions (YciB-GFP, yciB promoter-luciferase) to monitor expression

  • Expose bacteria to systematically varied environmental conditions

  • Evaluate YciB localization, expression, and post-translational modifications

  • Assess phenotypes of YciB mutants under these conditions

  • Determine if YciB contributes to sensing the "sweet spot" conditions that Salmonella requires for activating virulence systems

What role might bacteriophage therapy targeting S. Paratyphi A have on YciB function and bacterial susceptibility?

With emerging interest in bacteriophage therapy against Salmonella , understanding phage-YciB interactions could be valuable:

  • Isolation and characterization of S. Paratyphi A bacteriophages (similar to Sal11TP )

  • Comparison of phage infection efficiency between wild-type and ΔyciB strains

  • Identification of phage resistance mechanisms potentially involving YciB

  • Evaluation of combinatorial approaches using phages and conventional antibiotics

  • In vivo assessment of therapeutic potential using animal models

How does YciB contribute to antibiotic resistance mechanisms in S. Paratyphi A?

With rising antimicrobial resistance in S. Paratyphi A , YciB's potential role deserves investigation:

Table 9: Potential YciB Contributions to Antimicrobial Resistance

Resistance MechanismExperimental ApproachRelevance to YciB FunctionClinical Significance
Membrane permeabilityAntibiotic accumulation assaysAltered envelope integrityMultiple antibiotic classes
Efflux pump efficiencyEfflux inhibitor studiesMembrane protein interactionsMultidrug resistance
Cell division defectsTime-lapse microscopySeptation process alterationPersistence, tolerance
Stress responseTranscriptional profilingEnvironmental adaptationSurvival during therapy

Research methodology should include:

  • Minimum inhibitory concentration (MIC) determination for multiple antibiotics in wild-type vs. ΔyciB strains

  • Transcriptomic analysis to identify resistance genes differentially expressed in YciB mutants

  • Genetic interaction studies with known resistance determinants

  • Evaluation of persister cell formation and antibiotic tolerance

  • Correlation of specific yciB variants with antimicrobial resistance profiles in clinical isolates using approaches similar to the Paratype genotyping framework

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.