Recombinant Salmonella paratyphi A Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Salmonella Paratyphi A UbiB is a 546-amino acid protein (UniProt ID: Q5PKP2) expressed in E. coli with an N-terminal His tag . Key features include:

PropertySpecification
Expression SystemE. coli
Molecular Weight~61 kDa (calculated)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); -20°C/-80°C
Reconstitution0.1–1.0 mg/mL in sterile water; 5–50% glycerol for long-term stability

The full-length sequence (1–546 aa) includes conserved domains for ubiquinone biosynthesis and a variable central region critical for enzymatic activity .

Functional Role in Ubiquinone Biosynthesis

UbiB is essential for aerobic respiration in Salmonella spp., catalyzing early steps in ubiquinone (Q8) biosynthesis . Key findings:

  • Genetic Knockout Studies: ubiB mutants exhibit impaired Q8 production, leading to respiratory defects under aerobic conditions .

  • Virulence Link: UbiB is required for intracellular proliferation in macrophages, directly linking Q8 biosynthesis to bacterial pathogenesis .

  • Structural Insights: The C-terminal 50–63 amino acids are critical for function, restoring 17% of wild-type Q8 levels in complementation assays .

Diagnostic and Vaccine Development

  • Antigen Specificity: UbiB’s conserved epitopes make it a candidate for species-specific serodiagnostics .

  • Vaccine Components: Engineered outer membrane vesicles (GMMA) displaying UbiB and O:2 antigen induced bactericidal antibodies in mice, supporting its use in bivalent vaccines .

Genomic Surveillance

  • Paratype Tool: A SNP-based genotyping framework identified ubiB as a conserved marker across 18 Salmonella Paratyphi A genotypes, aiding global genomic tracking .

Comparative Analysis Across Salmonella Serovars

FeatureS. Paratyphi A (Q5PKP2) S. Paratyphi C (C0Q3E3)
Protein Length546 aa546 aa
O-Antigen LinkO:2 specificity Not reported
Expression YieldHigh (>90% purity) Comparable to Paratyphi A
Clinical RelevanceLinked to paratyphoid fever Limited data

Key Research Findings

  1. Antimicrobial Resistance (AMR): Genotype 2.3 ubiB variants correlate with IncHI1 plasmids carrying resistance genes (e.g., bla CTX-M-15) .

  2. Structural Mutations: Mutations in the O2-polysaccharide locus near ubiB impact vaccine efficacy, highlighting its role in antigenic variation .

  3. Oxygen-Independent Pathways: UbiB works with UbiJ/UbiT in a novel O2-independent hydroxylation pathway, expanding its role beyond aerobic conditions .

Future Directions

  • Vaccine Trials: Ongoing studies on O:2-CRM197 conjugate vaccines will validate UbiB’s role in broad-spectrum protection .

  • Structural Biology: Cryo-EM studies are needed to resolve UbiB’s catalytic mechanism and interaction with UbiJ/UbiV complexes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiB; SPA3813; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
ubiB
Target Protein Sequence
MTPGEVRRLYFIIRTFLSYGLDELIPRMRLTLPLRLWRYSLFWMPNRHKDKLLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGRLAKAQIEEAMGGLPVEA WFDDFDIQPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIQADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLYIPEVYSDYCSQNM MVMERIYGIPVSDVAALEKNGTNMKLLAERGVKVFFTQVFRDSFFHADMHPGNIFVSHEH PENPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEDFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWVEKMPEIPELVYDSLRQGKYLQH SVDKIARELQVNHVRQSQSRYLLGIGATLLLSGSFLLVNRPEWGLMPGWLMVGGVVVWLV GWRKTR
Uniprot No.

Target Background

Function
UbiB, a probable protein kinase regulator, plays a role in regulating UbiI activity, which is involved in the aerobic biosynthesis of coenzyme Q (ubiquinone).
Database Links

KEGG: spt:SPA3813

Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UbiB and what is its role in Salmonella paratyphi A?

UbiB is a probable ubiquinone biosynthesis protein in Salmonella paratyphi A that participates in the synthesis of ubiquinone (UQ, also called coenzyme Q). In bacterial systems like S. paratyphi A, UbiB is one of the essential components in the UQ biosynthetic pathway. Evidence suggests it serves as an accessory protein rather than having direct enzymatic activity.

Methodological approach: To study UbiB function, researchers typically create knockout mutants (ΔubiB) in S. paratyphi A and analyze changes in ubiquinone levels using HPLC analysis coupled to electrochemical detection (ECD). Complementation studies with plasmid-expressed UbiB can confirm phenotype rescue.

How does UbiB function relate to S. paratyphi A pathogenesis?

UbiB's role in ubiquinone biosynthesis makes it critical for bacterial bioenergetics and electron transport. In S. enterica (closely related to S. paratyphi A), disruption of ubiquinone biosynthesis through mutations in biosynthetic proteins has been shown to reduce virulence and intracellular survival. Research has demonstrated that defects in ubiquinone biosynthesis genes, including ubiB, impair the ability of Salmonella to proliferate in macrophages and reduce virulence in mouse models .

Methodological approach: Researchers can assess the impact of UbiB on pathogenesis using macrophage infection assays, comparing survival rates of wild-type and ΔubiB mutants. In vivo virulence can be evaluated in mouse models by measuring bacterial loads in tissues after infection.

What experimental systems are best suited for studying S. paratyphi A UbiB?

For in vitro studies, recombinant UbiB can be expressed in E. coli expression systems. Based on related Ubi proteins, several approaches are recommended:

Expression systems:

  • E. coli BL21(DE3) with pACYCDuet-1 plasmid has been successfully used for related Ubi proteins

  • IPTG-inducible systems with controlled temperature (typically 25-30°C) to enhance solubility

Purification techniques:

  • Affinity chromatography using His6-tagged constructs

  • Size exclusion chromatography to obtain pure protein

  • Multi-angle light scattering (SEC-MALS) to determine oligomeric state

For functional studies, S. paratyphi A challenge models and macrophage infection models are most relevant .

How does UbiB interact with other proteins in the ubiquinone biosynthesis pathway?

Based on studies of related proteins in the ubiquinone biosynthesis pathway, UbiB likely functions as part of a multi-protein complex. Research on UbiK, another ubiquinone biosynthesis accessory factor, has demonstrated interactions with multiple Ubi proteins, including UbiB . These interactions were confirmed through bacterial two-hybrid (BACTH) reporter systems.

Interaction data from related systems:

ProteinInteracts with UbiB?Verification method
UbiKYesBACTH system
UbiJIndirect (via UbiK)Pulldown assays
UbiEUnknown for UbiBRequires investigation
UbiFUnknown for UbiBRequires investigation
UbiGUnknown for UbiBRequires investigation

Methodological approach: Researchers studying UbiB interactions should employ multiple complementary techniques:

  • Bacterial two-hybrid systems to screen for potential interactions

  • Co-immunoprecipitation with tagged UbiB to pull down interaction partners

  • Pulldown assays with MBP-tagged UbiB as bait

  • Surface plasmon resonance or isothermal titration calorimetry for quantitative binding parameters

What are the differences in UbiB expression and function between aerobic and anaerobic conditions?

Evidence from related ubiquinone biosynthesis proteins indicates condition-specific requirements. For example, UbiK and UbiJ are dispensable for UQ biosynthesis under anaerobiosis, even though they are expressed in the absence of oxygen . Since ubiquinone functions primarily in aerobic respiration, UbiB's role may be similarly condition-dependent.

Methodological approach: To investigate this question:

  • Perform RNA-seq or qPCR analysis of ubiB expression under aerobic vs. anaerobic conditions

  • Measure ubiquinone levels in wild-type and ΔubiB strains under both conditions using HPLC-ECD

  • Conduct growth experiments comparing ΔubiB mutant fitness in aerobic vs. anaerobic environments

  • Use promoter-reporter fusions (e.g., ubiB-lacZ) to visualize expression patterns under different oxygen tensions

How does the structure of S. paratyphi A UbiB relate to its function?

While specific structural data for S. paratyphi A UbiB is limited, computational analysis suggests it likely belongs to the protein kinase-like superfamily with an ABC1 domain. The structure-function relationship could be investigated through:

Methodological approach:

  • Homology modeling based on related structures

  • Site-directed mutagenesis of predicted active site or protein interaction domains

  • X-ray crystallography or cryo-EM of purified recombinant UbiB

  • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions and protein interaction surfaces

What are optimal methods for expressing and purifying S. paratyphi A UbiB?

Based on successful approaches with related proteins, researchers should consider:

Expression optimization:

  • Test multiple E. coli strains (BL21, Rosetta, Arctic Express)

  • Vary induction conditions (IPTG concentration, temperature, duration)

  • Try fusion tags (His6, MBP, SUMO) to improve solubility

  • Consider codon optimization for bacterial expression

Purification strategy:

  • Affinity chromatography (Ni-NTA for His-tagged proteins)

  • Ion exchange chromatography to remove contaminants

  • Size exclusion chromatography for final polishing

  • Validate purity by SDS-PAGE and Western blotting

  • Confirm identity by mass spectrometry

For functional characterization, ensure the removal of the fusion tag does not affect protein activity and verify proper folding using circular dichroism spectroscopy.

How can researchers design effective gene knockout strategies for studying UbiB function?

Several approaches for creating ubiB knockouts can be considered:

Lambda Red recombination method:

  • Amplify an antibiotic resistance cassette with flanking homology to ubiB

  • Transform into S. paratyphi A expressing Lambda Red recombinase

  • Select for antibiotic-resistant colonies

  • Verify deletion by PCR and sequencing

CRISPR-Cas9 method:

  • Design guide RNAs targeting ubiB

  • Clone into CRISPR-Cas9 plasmid with homology repair template

  • Transform into S. paratyphi A

  • Select and verify deletions

Phenotypic analysis:

  • Compare growth rates in minimal vs. rich media

  • Measure ubiquinone levels by HPLC-ECD

  • Assess bacterial survival under oxidative stress

  • Test complementation with wild-type ubiB gene

What assays can measure UbiB function and ubiquinone biosynthesis in S. paratyphi A?

Quantitative assays for ubiquinone:

  • HPLC coupled to electrochemical detection (HPLC-ECD) - The gold standard for quantifying ubiquinone levels in bacterial extracts

  • Mass spectrometry for detailed profiling of ubiquinone and intermediates

  • UV-visible spectroscopy (275 nm) for preliminary detection

Functional assays:

  • Bacterial growth under different electron acceptor conditions

  • Oxygen consumption rate measurements

  • Membrane potential assays using fluorescent dyes

  • ATP production measurements

Biosynthetic intermediate analysis:

  • Monitor accumulation of octaprenylphenol (OPP) or other intermediates by HPLC and mass spectrometry

  • In the absence of functional UbiB, S. paratyphi A likely accumulates early intermediates of the UQ biosynthetic pathway, similar to what has been observed with ubiK mutants

How can researchers overcome challenges in studying membrane-associated proteins like UbiB?

UbiB, being involved in ubiquinone biosynthesis, likely associates with membranes, presenting specific challenges:

Solubility optimization strategies:

  • Use mild detergents during purification (DDM, LDAO, or Triton X-100)

  • Test different detergent concentrations and buffer compositions

  • Consider amphipols or nanodiscs for maintaining native environment

  • Explore membrane scaffold proteins (MSPs) for reconstitution studies

Alternative approaches:

  • Domain-based studies of soluble regions

  • Cell-free expression systems

  • In silico modeling combined with targeted mutagenesis

  • Split-protein complementation assays for interaction studies

How can UbiB research contribute to understanding S. paratyphi A pathogenesis?

S. paratyphi A causes paratyphoid fever, a significant global health concern with rising antimicrobial resistance . Understanding UbiB's role can provide insights into:

  • Metabolic adaptations during infection:

    • Measure ubiquinone levels in bacteria isolated from infection models

    • Compare metabolite profiles of wild-type vs. ΔubiB mutants during infection

    • Analyze gene expression changes in response to host environments

  • Potential as antimicrobial target:

    • Screen for small molecule inhibitors of UbiB function

    • Test synergy between UbiB inhibitors and existing antibiotics

    • Evaluate resistance development potential

  • Vaccine development implications:

    • Assess whether UbiB disruption affects expression of immunogenic surface structures

    • Evaluate attenuated ΔubiB strains as potential live vaccine candidates

    • Investigate UbiB as a potential protein antigen for subunit vaccines

How might systems biology approaches enhance understanding of UbiB in ubiquinone biosynthesis?

Systems biology offers powerful approaches to contextualizing UbiB function:

Multi-omics integration:

  • Combine transcriptomics, proteomics, and metabolomics data from wild-type and ΔubiB strains

  • Map flux changes in central metabolism when UbiB function is disrupted

  • Identify compensatory pathways activated in UbiB mutants

Network analysis:

  • Construct protein-protein interaction networks centered on UbiB

  • Identify genetic interactions through synthetic lethality screens

  • Model metabolic consequences of UbiB disruption using flux balance analysis

Proposed experimental workflow:

  • Generate comprehensive -omics datasets from defined conditions

  • Develop computational models of ubiquinone biosynthesis

  • Validate model predictions through targeted experiments

  • Iterate between modeling and experimental validation

What is the potential of UbiB as a target for novel antimicrobials against S. paratyphi A?

The increasing prevalence of antimicrobial resistance in S. paratyphi A (particularly in South Asia ) necessitates new therapeutic approaches. UbiB represents a potential target based on:

  • Essential metabolic function: Disruption of ubiquinone biosynthesis affects bacterial bioenergetics

  • Virulence connection: Related ubi genes are implicated in Salmonella virulence

  • Limited host toxicity potential: Structural differences from human homologs could allow selective targeting

Research strategy:

  • Perform high-throughput screening for UbiB inhibitors

  • Evaluate hit compounds in bacterial growth and infection models

  • Optimize lead compounds for potency and selectivity

  • Assess resistance development potential

How does UbiB contribute to S. paratyphi A's metabolic adaptation during infection?

S. paratyphi A encounters various host environments during infection. UbiB's role in ubiquinone biosynthesis may be particularly important for:

  • Adaptation to oxygen-limited environments: Host tissues often have reduced oxygen tension

  • Response to oxidative stress: Phagocyte-generated reactive oxygen species require metabolic adaptation

  • Nutrient limitation: Host-imposed nutrient restriction may affect ubiquinone-dependent metabolism

Experimental approaches:

  • Compare transcription of ubiB under various in vitro conditions mimicking host environments

  • Analyze metabolite profiles in wild-type vs. ΔubiB strains under infection-relevant conditions

  • Use tissue culture and animal models to assess the impact of UbiB on bacterial adaptation during infection stages

  • Apply metabolomics approaches similar to those used to distinguish S. Typhi and S. Paratyphi A infections

Research Data Tables

Table 1: Key Phenotypes of Ubiquinone Biosynthesis Mutants in Salmonella

MutantUQ₈ Content (% of WT)Intermediates AccumulatedGrowth Phenotype (Aerobic)Growth Phenotype (Anaerobic)Virulence Impact
ΔubiK18%Octaprenylphenol (OPP)No defect in LBNormalReduced proliferation in macrophages, reduced virulence in mice
ΔubiJSignificantly reducedOctaprenylphenol (OPP)DefectNormalReduced virulence
ΔubiB*Requires investigationLikely early intermediatesRequires investigationLikely normalRequires investigation

*Based on related Ubi proteins; specific data for UbiB needs further investigation
Data derived from references

Table 2: S. paratyphi A Challenge Model Characteristics

Challenge Dose (CFU)Attack RateTime to Bacteremia (Median)Duration of Bacteremia (Median)Clinical Manifestations
1-5 × 10³60%5.2 days4.1 daysLimited symptoms, high rates of subclinical bacteremia (55%)
0.5-1 × 10³40%7.0 days1.0 dayEven more limited symptoms

Data derived from reference

Table 3: Predicted Protein-Protein Interactions in Ubiquinone Biosynthesis

ProteinInteracts with UbiKEvidence MethodPotential UbiB Interaction
UbiBYesBACTH systemN/A (self)
UbiEYesBACTH systemRequires investigation
UbiFYesBACTH systemRequires investigation
UbiGYesBACTH systemRequires investigation
UbiHYesBACTH systemRequires investigation
UbiIYesBACTH systemRequires investigation
UbiJYesBACTH system, co-purification, pulldownPotential indirect interaction via UbiK
UbiXYesBACTH systemRequires investigation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.