Recombinant Salmonella paratyphi A Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
lgt; SSPA2670; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPDFDPVIFSIGPVALHWYGLMYLVGFVFAMWLAVRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPLFLDNPLYLFRVWDGGMSFHGGLIGVILVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFRFAMLFPGSRAEDIALLPSH PQWQPIFDTYGVLPRHPSQLYELALEGVVLFIILNLFIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIIAGAIMMVWAYRRRPQQHVS
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the first step in the formation of mature lipoproteins.
Database Links

KEGG: sek:SSPA2670

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and what role does it play in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification pathway of bacterial lipoproteins. This enzyme is critical for bacterial survival, as the deletion of the lgt gene is lethal to most Gram-negative bacteria . Lgt specifically transfers the diacylglyceryl moiety from phosphatidylglycerol to pre-prolipoproteins, initiating the lipid modification process that anchors proteins to the bacterial membrane . These lipoproteins serve essential functions in bacterial physiology, including maintenance of cell envelope architecture, insertion and stabilization of outer membrane proteins, nutrient uptake, transport, adhesion, invasion, and virulence .

How conserved is the lgt gene among Salmonella strains?

The lgt gene demonstrates high conservation across Salmonella strains, similar to other genes involved in essential cellular processes. While specific data on lgt conservation in S. paratyphi A isn't directly provided in the search results, we can draw parallels from studies of other conserved genes in this pathogen. For instance, studies on S. paratyphi A have shown that genes like spaO and h1a exhibit high sequence conservation with similarities ranging from 99.31% to 99.88% across different isolates . This high conservation is typical for genes involved in fundamental cellular processes, suggesting that lgt likely follows a similar pattern of conservation due to its essential role in bacterial survival.

What expression systems are most effective for producing recombinant S. paratyphi A lgt?

For the expression of recombinant S. paratyphi A lgt, E. coli-based expression systems are commonly employed. When expressing membrane proteins like lgt, several methodological considerations are crucial:

  • Expression vector selection: Vectors with inducible promoters (such as T7 or araBAD) allow controlled expression to prevent toxicity.

  • Host strain optimization: Strains like BL21(DE3), C41(DE3), or C43(DE3) are often preferred for membrane protein expression due to their tolerance for toxic proteins.

  • Expression conditions: Lower temperatures (16-25°C) and reduced inducer concentrations often improve proper folding and membrane insertion.

  • Detergent screening: A panel of detergents should be tested for optimal solubilization of the expressed lgt from membranes while maintaining protein stability and activity.

The expression protocol may require optimization specific to lgt, as membrane proteins often present unique challenges in recombinant production systems. Fusion tags may be included during the production process to facilitate purification, as noted in commercial preparations of this protein .

What are the key structural features of S. paratyphi A lgt?

While no crystal structure specifically for S. paratyphi A lgt is mentioned in the search results, structural insights can be gained from the E. coli Lgt homolog. The crystal structures of E. coli Lgt have been resolved at high resolution (1.9Å with phosphatidylglycerol and 1.6Å with palmitic acid inhibitor) . Key structural features include:

  • Transmembrane domains: As an integral membrane protein, lgt contains multiple transmembrane segments that anchor it in the bacterial membrane.

  • Two binding sites: The structures reveal the presence of two distinct binding sites within the protein .

  • Critical residues: Arg143 and Arg239 have been identified as essential for diacylglyceryl transfer activity .

  • Lateral access: The structural data supports a mechanism whereby substrate and lipid-modified product enter and leave the enzyme laterally relative to the lipid bilayer .

The full-length S. paratyphi A lgt (UniProt: B5BFG7) contains 291 amino acids with a specific sequence that determines its function and membrane localization .

What are the critical residues for lgt enzymatic function and how were they identified?

Critical residues in lgt, particularly Arg143 and Arg239, have been identified as essential for diacylglyceryl transfer activity . These findings were established through a systematic approach:

  • Structural analysis: Crystal structures of E. coli Lgt at high resolution (1.9Å and 1.6Å) provided the initial identification of potentially important residues based on their positioning in substrate-binding pockets or catalytic sites .

  • Site-directed mutagenesis: Targeted mutations were introduced at specific amino acid positions.

  • Complementation studies: The functionality of mutant Lgt variants was assessed through complementation experiments in lgt-knockout cells, which revealed which residues were essential for enzyme function .

  • In vitro activity assays: A GFP-based in vitro assay was used to correlate the activities of Lgt variants with structural observations, providing quantitative measurements of enzyme function .

These experimental approaches collectively established the importance of specific residues, with Arg143 and Arg239 identified as particularly critical for the diacylglyceryl transfer reaction .

What methodological approaches are effective for assessing the enzymatic activity of recombinant lgt?

Several complementary methodologies can be employed to assess the enzymatic activity of recombinant lgt:

  • GFP-based in vitro assay: This approach allows for real-time monitoring of lgt activity by measuring the incorporation of fluorescently labeled lipid substrates into prolipoproteins .

  • Radioactive assays: Using radiolabeled phosphatidylglycerol as a substrate to measure the transfer of diacylglyceryl moieties to acceptor prolipoproteins.

  • Mass spectrometry: To detect and quantify lipid modifications on substrate proteins before and after treatment with lgt.

  • Complementation studies: Testing the ability of recombinant lgt to restore function in lgt-knockout bacterial strains provides a functional readout of enzyme activity .

  • Structural analysis: Techniques such as X-ray crystallography can provide insights into substrate binding and catalytic mechanisms when performed with substrates or substrate analogs .

These methods can be used individually or in combination to comprehensively characterize the enzymatic properties of recombinant lgt proteins.

What purification strategies are most effective for obtaining high-purity recombinant S. paratyphi A lgt?

Purifying membrane proteins like lgt requires specialized approaches due to their hydrophobic nature. An effective purification strategy typically involves:

  • Membrane isolation: After cell lysis, differential centrifugation is used to isolate bacterial membranes containing the overexpressed lgt.

  • Detergent solubilization: The membrane fraction is solubilized using detergents such as n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or lauryl maltose neopentyl glycol (LMNG).

  • Affinity chromatography: If the recombinant lgt includes an affinity tag (as often determined during the production process ), appropriate affinity chromatography (Ni-NTA for His-tags, glutathione sepharose for GST-tags) can be used for initial purification.

  • Size exclusion chromatography: This step separates the protein based on size and can remove aggregates and other contaminants.

  • Storage considerations: The purified protein is typically stored in a Tris-based buffer with 50% glycerol to maintain stability, as recommended for commercial preparations .

For optimal results, the purification process should be performed at 4°C whenever possible, and the addition of protease inhibitors is recommended to prevent degradation.

How can researchers evaluate the immunogenicity of recombinant S. paratyphi A lgt?

Evaluating the immunogenicity of recombinant S. paratyphi A lgt involves a multi-tiered approach:

  • Animal models: Immunization studies in mice can assess the capacity of recombinant lgt to elicit immune responses. Protection rates against subsequent infection can be measured, similar to studies with other S. paratyphi A antigens that showed 41.7-66.7% protection with single antigens .

  • Serological assays: ELISA can be used to detect anti-lgt antibodies in sera from immunized animals or paratyphoid A patients. High detection rates of antibodies against other S. paratyphi A antigens (94.8-98.8%) have been observed in patient sera .

  • Cellular immunity assessment: T-cell responses can be evaluated through techniques such as ELISpot, intracellular cytokine staining, and proliferation assays.

  • Challenge studies: Protection efficacy can be assessed through challenge with virulent S. paratyphi A strains in appropriate animal models, measuring outcomes such as bacterial clearance, disease symptoms, and survival rates.

  • Adjuvant evaluation: Different adjuvant formulations can be tested to optimize immune responses to the recombinant protein.

This comprehensive approach provides insights into both humoral and cellular immune responses elicited by the antigen, informing its potential utility in vaccine development.

What is the potential of recombinant lgt as a component in S. paratyphi A vaccine development?

The potential of recombinant lgt as a component in S. paratyphi A vaccine development can be evaluated based on several criteria:

  • Conservation and distribution: High conservation of antigens across isolates is crucial for broad-spectrum protection. Other S. paratyphi A antigens such as spaO and h1a show wide distribution (97.5-100%) and high sequence conservation (99.31-99.88%) , suggesting that conserved proteins like lgt may offer similar advantages.

  • Expression patterns: Consistent expression of the antigen during infection is important for vaccine efficacy. High expression frequencies have been observed for other S. paratyphi A antigens (98-100%) .

  • Immunogenicity: The ability to elicit strong antibody responses is critical. For comparison, anti-SpaO and anti-H1a IgGs were detectable in 94.8% and 98.8% of paratyphoid A patients, respectively .

  • Protection efficacy: Studies with other S. paratyphi A antigens showed protection rates of 41.7-66.7% with single antigens, increasing to 75.0-91.7% when antigens were combined . This suggests that lgt might be most effective as part of a multi-antigen vaccine.

  • Functional role: As lgt is essential for bacterial survival in most Gram-negative bacteria , targeting this enzyme could potentially disrupt critical pathogen functions.

The absence of a licensed vaccine for paratyphoid A fever underscores the need for continued exploration of promising antigens like lgt, particularly in combination with other protective antigens to achieve optimal efficacy.

How does lgt contribute to S. paratyphi A virulence and pathogenesis?

Prolipoprotein diacylglyceryl transferase (lgt) contributes to S. paratyphi A virulence and pathogenesis through several mechanisms:

  • Essential lipoproteins: Lgt catalyzes the first step in lipoprotein biogenesis, and many of these lipoproteins are critical virulence factors involved in adhesion, invasion, and nutrient acquisition .

  • Cell envelope integrity: Proper lipoprotein processing is essential for maintaining the structural integrity of the bacterial cell envelope, which protects the pathogen from host defense mechanisms.

  • Host-pathogen interactions: Lipoproteins modified by lgt can serve as pathogen-associated molecular patterns (PAMPs) that interact with host pattern recognition receptors, influencing immune response and pathogenesis.

  • Stress resistance: Properly processed lipoproteins contribute to bacterial resistance to environmental stresses encountered during infection, including antimicrobial peptides and oxidative stress.

  • Bacterial survival: The essentiality of lgt in most Gram-negative bacteria indicates its fundamental role in bacterial viability, which is a prerequisite for pathogenesis.

Understanding these contributions can inform therapeutic approaches targeting lgt or its products, potentially disrupting critical aspects of S. paratyphi A pathogenesis.

What gene knockout or mutation strategies can be used to study lgt function in S. paratyphi A?

Since lgt is essential for survival in most Gram-negative bacteria , traditional knockout approaches may not be viable. Instead, researchers can employ several alternative strategies:

  • Conditional knockout systems:

    • Inducible promoter control: Replace the native lgt promoter with an inducible promoter to allow controlled expression shutdown.

    • Temperature-sensitive mutants: Generate temperature-sensitive lgt variants that function normally at permissive temperatures but lose function at restrictive temperatures.

  • Partial function mutations:

    • Site-directed mutagenesis: Target specific residues like Arg143 and Arg239 that are critical for function to create partially functional variants.

    • Domain deletions: Remove specific functional domains while preserving minimal activity for survival.

  • Complementation studies:

    • Express wild-type or mutant lgt variants in strains with compromised endogenous lgt to assess functional rescue .

  • Comparative approaches:

    • Study lgt function in related Salmonella serotypes where similar mutagenesis studies have been conducted, such as the phoPQ-deleted strains in S. paratyphi A that showed altered sensitivity to deoxycholate and polymyxin B .

These approaches can provide valuable insights into lgt function while circumventing the lethality associated with complete gene deletion.

How does S. paratyphi A lgt compare to lgt from other bacterial species?

The following table compares key features of lgt across different bacterial species:

FeatureS. paratyphi A lgtE. coli lgtOther Gram-negative lgtGram-positive lgt
Length291 amino acids Similar (approximately 290-300 aa)Typically 290-310 aaOften slightly larger
Essential for viabilityLikely essentialEssential Essential in most species Non-essential in some species
Crystal structureNot yet determinedResolved at 1.6-1.9Å Limited structural dataLimited structural data
Critical residuesLikely Arg143, Arg239 (by homology)Arg143, Arg239 Conserved catalytic residuesSimilar catalytic architecture
Substrate specificityPhosphatidylglycerolPhosphatidylglycerol Primarily phosphatidylglycerolMay accept wider range of substrates
InhibitorsFatty acids (by homology)Palmitic acid Various fatty acidsVarious fatty acids and antimicrobials

This comparative analysis highlights both the conserved features of lgt across bacterial species and the potential species-specific variations that may influence function and druggability.

What methodological differences exist between studying recombinant lgt and native lgt in S. paratyphi A?

AspectRecombinant lgtNative lgt
SourceHeterologous expression systems (e.g., E. coli) Direct isolation from S. paratyphi A
PurityHigh purity achievable with affinity tags Lower purity; contamination with other membrane proteins
YieldHigher yields possible with optimized expressionLimited by natural expression levels
Native conformationMay have altered folding or post-translational modificationsAuthentic structure and modifications
Analytical methodsAmenable to in vitro assays, structural studies More suitable for in vivo functional studies
Membrane environmentReconstituted in detergent micelles or artificial membranesLocated in native bacterial membrane
Fusion tagsOften includes affinity or solubility tags No artificial tags
Application in immunological studiesCan be used for antibody production and immunogenicity assessmentDifficult to isolate in sufficient quantities for immunization
Protein-protein interactionsMay not maintain all native interaction partnersExists in natural protein complexes
Storage stabilityCan be optimized (e.g., 50% glycerol, -20°C) Stable only in intact cells or carefully preserved membranes

This methodological comparison provides researchers with insights into selecting the appropriate experimental approach based on their specific research questions and available resources.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.