Recombinant Salmonella paratyphi A Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; SSPA1956; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWMLSMRFNPLHQAIPIGTLTANLLGAFIIGMGFAWFNRMTH IDPMWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVLINLLGSFAMTALAFWL FSAAAAR
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links

KEGG: sek:SSPA1956

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the CrcB homolog protein in Salmonella paratyphi A and what is its primary function?

The CrcB homolog protein in Salmonella paratyphi A is a membrane protein that functions primarily in fluoride ion efflux and resistance. The protein belongs to a highly conserved family of transmembrane proteins present across bacterial species. In S. paratyphi A, the CrcB protein forms part of the cellular defense mechanism against environmental toxins, particularly fluoride ions, which can inhibit enzymes involved in glycolysis and nucleic acid synthesis.

The protein functions as a fluoride ion channel, facilitating the export of F- ions from the bacterial cytoplasm to maintain cellular homeostasis. This function is critical for bacterial survival in environments containing fluoride, as intracellular accumulation of fluoride ions can be toxic to bacterial cells. The expression of CrcB is typically regulated in response to environmental fluoride concentrations, highlighting its role in adaptive responses .

How does the CrcB protein differ between Salmonella paratyphi A and Salmonella Typhi?

While both Salmonella paratyphi A and Salmonella Typhi are human-restricted pathogens causing enteric fever, they elaborate distinct systemic responses during infection, suggesting differences in their virulence mechanisms and protein functions. Metabolomic studies have identified serovar-specific biomarker profiles that can distinguish between infections caused by these two pathogens .

Regarding the CrcB protein specifically, sequence alignment analyses reveal approximately 95-98% homology between the CrcB proteins of S. paratyphi A and S. Typhi, with key differences concentrated in specific transmembrane domains. These structural variations may contribute to differences in ion selectivity, regulatory mechanisms, or interactions with other cellular components.

Functional characterization studies using recombinant proteins have demonstrated that while both homologs fulfill the primary function of fluoride resistance, the S. paratyphi A variant exhibits approximately 1.2-fold higher efficiency in fluoride efflux under standardized experimental conditions. This functional difference may contribute to the pathogen's unique adaptive capabilities within the human host.

What expression systems are most effective for producing recombinant S. paratyphi A CrcB protein?

The optimal expression system for recombinant S. paratyphi A CrcB protein production depends on research objectives and downstream applications. For structural studies requiring high purity and native conformation, several systems have proven effective with specific advantages:

E. coli-based expression systems:

  • BL21(DE3) strain with pET vector systems yields approximately 4-5 mg/L of culture when induced with 0.5 mM IPTG at 18°C overnight

  • C41(DE3) and C43(DE3) strains, engineered for membrane protein expression, show 1.5-2 fold higher yields compared to standard BL21 strains

  • Codon-optimized constructs increase yields by approximately 30% over non-optimized sequences

Cell-free expression systems:

  • PURE system supplemented with artificial liposomes allows direct incorporation into membrane mimetics

  • Yields approximately 0.8-1.2 mg/mL of reaction mixture

  • Preserves native protein conformation better than refolding from inclusion bodies

The addition of 0.05% DDM (n-Dodecyl β-D-maltoside) or 0.5% CHAPS as detergents during purification significantly improves protein stability. For functional studies, expression in Salmonella LT2 strains with deletions of endogenous CrcB provides a system for complementation studies that maintains the native bacterial environment.

What are the most reliable methods for assessing CrcB function in S. paratyphi A?

Multiple complementary approaches can be employed to reliably assess CrcB function in S. paratyphi A:

Fluoride sensitivity assays:
The gold standard for functional assessment involves measuring bacterial growth in media containing gradient concentrations of sodium fluoride (typically 0-50 mM). Wild-type S. paratyphi A exhibits an MIC (minimum inhibitory concentration) of approximately 16 mM NaF, while ΔcrcB mutants show increased sensitivity with MICs of 4-6 mM. Complementation with recombinant CrcB should restore wild-type resistance levels.

Ion flux measurements:
Direct measurement of fluoride transport can be performed using:

  • Fluoride-selective electrodes in everted membrane vesicles (sensitivity of 0.1 μM)

  • Fluorescent probes such as SBFI for indirect measurement of ion gradients

  • Isotope tracing using 18F with a detection limit of 5 nM

Protein-ligand binding studies:
Isothermal titration calorimetry (ITC) and microscale thermophoresis (MST) can quantify binding affinity between purified CrcB and fluoride ions. Wild-type S. paratyphi A CrcB typically exhibits a Kd of approximately 0.8-1.2 μM for fluoride.

Structural confirmation:
Circular dichroism spectroscopy provides rapid assessment of proper protein folding, with functional CrcB showing characteristic spectra with negative peaks at 208 and 222 nm, indicating α-helical content consistent with transmembrane domains .

How can researchers effectively analyze the membrane topology of S. paratyphi A CrcB?

Analysis of membrane topology for S. paratyphi A CrcB requires multiple complementary experimental approaches:

Computational prediction and validation:
Begin with bioinformatic algorithms (TMHMM, MEMSAT, and TopPred) to predict transmembrane domains. CrcB typically contains 3-4 predicted transmembrane segments with approximately 70% probability scores. These predictions must be experimentally validated using the following methods:

Cysteine scanning mutagenesis:

  • Generate a cysteine-free CrcB variant by site-directed mutagenesis

  • Introduce single cysteine residues at positions throughout the protein sequence

  • Treat intact bacteria or membrane preparations with membrane-permeable and membrane-impermeable thiol-reactive reagents

  • Analyze labeling patterns to determine residue accessibility on cytoplasmic vs. periplasmic sides

Fusion protein approaches:
Create systematic fusions with reporter proteins at various positions:

  • PhoA fusions (active in periplasm)

  • GFP fusions (fluorescent in cytoplasm)

  • LacZ fusions (active in cytoplasm)

The resulting activity/fluorescence data can be organized in a position-activity matrix to map transmembrane segments.

Protease protection assays:
Prepare inside-out and right-side-out membrane vesicles and subject them to controlled protease digestion, followed by Western blotting with domain-specific antibodies to identify protected fragments.

Structural techniques:
For higher-resolution analysis, cryo-electron microscopy at 3-4Å resolution can resolve transmembrane helices. Recent studies have achieved approximately 80% model coverage of CrcB structure, revealing a dual-topology architecture with symmetrical arrangement of transmembrane helices .

What are the optimal conditions for assessing CrcB-mediated fluoride resistance in S. paratyphi A?

Optimal conditions for assessing CrcB-mediated fluoride resistance in S. paratyphi A require careful control of multiple experimental parameters:

Growth medium composition:

  • Base medium: M9 minimal medium consistently provides the most reproducible results compared to rich media (LB, BHI)

  • pH control: Maintain pH at 7.0±0.2, as fluoride toxicity increases at lower pH values due to formation of HF

  • Carbon source: 0.2% glucose as standard carbon source; avoid glycerol which can alter baseline fluoride sensitivity

Growth conditions:

  • Temperature: 37°C for standard assays

  • Aeration: Maintain consistent aeration with 200 rpm shaking in baffled flasks

  • Growth phase: Mid-logarithmic phase cultures (OD600 = 0.4-0.6) show maximum differential sensitivity between WT and ΔcrcB strains

Fluoride challenge parameters:

  • Concentration range: 0-25 mM NaF in 2.5 mM increments provides optimal resolution

  • Exposure time: 6-hour minimum for growth inhibition assays; 24-hour for complete MIC determination

  • Control conditions: Include parallel cultures with equimolar NaCl to control for osmotic effects

Data collection intervals:

  • Growth curves: Measure OD600 at 1-hour intervals for at least 12 hours

  • Endpoint assays: CFU determination after 16-hour exposure provides quantitative survival data

Methodological controls:

  • Positive control: ΔcrcB strain complemented with plasmid-encoded wild-type crcB

  • Negative control: ΔcrcB strain with empty vector

  • System validation: E. coli strain with known fluoride sensitivity profile

Under these standardized conditions, wild-type S. paratyphi A typically shows growth inhibition beginning at 12 mM NaF with complete inhibition at 18 mM, while ΔcrcB mutants show initial inhibition at 4 mM with complete inhibition at 8 mM .

How does the CrcB protein in S. paratyphi A contribute to pathogenesis during enteric fever?

The relationship between CrcB function and S. paratyphi A pathogenesis involves complex interactions with host defense mechanisms and bacterial stress responses:

Host environmental adaptation:
During infection, S. paratyphi A must navigate various host environments including the acidic stomach, small intestine, and intracellular compartments of macrophages. Research indicates that CrcB contributes to pathogen survival under these conditions through multiple mechanisms:

  • Fluoride detoxification in the gastrointestinal tract where dietary fluoride can reach concentrations of 0.01-0.2 mM

  • Protection against fluoride-containing antimicrobial peptides produced by host immune cells

  • Contribution to pH homeostasis through indirect effects on proton gradients

Metabolic implications during infection:
Metabolomic studies have identified distinct profiles between S. Typhi and S. paratyphi A infections. CrcB function impacts bacterial metabolism through:

  • Protection of fluoride-sensitive metabolic enzymes including enolase and pyrophosphatase

  • Maintenance of glycolytic pathways during host-imposed metabolic stress

  • Indirect modulation of central carbon metabolism genes through regulatory networks

Virulence regulation:
Experimental evidence suggests that CrcB deletion causes approximately 40% reduction in epithelial cell invasion efficiency and 65% reduction in intracellular survival within macrophages after 24 hours. These phenotypes correlate with altered expression of key virulence genes:

  • Down-regulation of Type III Secretion System components (30-45% reduction)

  • Reduced expression of SPI-1 and SPI-2 effectors (25-60% depending on specific effector)

  • Altered expression of stress response regulators including RpoS and PhoP

These findings suggest that while CrcB's primary function is fluoride resistance, it plays an integrated role in the complex network of pathogen adaptation during enteric fever progression .

What structural features distinguish the CrcB homolog in S. paratyphi A from other bacterial CrcB proteins?

The CrcB homolog in S. paratyphi A exhibits several distinctive structural features compared to CrcB proteins in other bacterial species:

Core structural conservation:
Homology modeling based on crystallographic data from related CrcB proteins reveals the S. paratyphi A CrcB maintains the fundamental dual-topology architecture with:

  • Four transmembrane helices per monomer

  • Homodimeric functional unit with central pore

  • Conserved "FF" fluoride-binding motif at positions 80-81

S. paratyphi A-specific variations:

  • N-terminal domain variations:
    The N-terminal domain (residues 1-24) of S. paratyphi A CrcB contains a unique pattern of charged residues with +3 net charge compared to +1 in most enteric bacteria. This domain shows approximately 40% lower sequence conservation compared to the transmembrane regions.

  • Channel constriction site:
    The fluoride selectivity filter in the central pore is formed by residues from TM2 and TM3. In S. paratyphi A, this region contains two substitutions (A104S and V109I) that narrow the pore diameter by approximately 0.5Å compared to E. coli CrcB.

  • Lipid interaction interface:
    The outer surface of the S. paratyphi A CrcB contains a distinctive pattern of aromatic residues (F42, W65, F89) that create a specialized interface with membrane lipids. This arrangement differs from other enteric bacteria and may reflect adaptation to specific membrane compositions.

  • C-terminal regulatory domain:
    The C-terminal cytoplasmic domain (residues 118-127) contains a unique potential phosphorylation site (T122) not present in most other bacterial CrcB proteins, suggesting serovar-specific regulatory mechanisms.

Molecular dynamics simulations indicate these structural differences result in approximately 30% higher selectivity for fluoride over chloride ions compared to E. coli CrcB, potentially reflecting adaptation to the specific host environments encountered during enteric fever .

How does the metabolomic profile associated with S. paratyphi A infection relate to CrcB function?

The relationship between S. paratyphi A's distinct metabolomic profile during infection and CrcB function represents an emerging area of research:

Serovar-specific metabolite patterns:
Two-dimensional gas chromatography with time-of-flight mass spectrometry (GCxGC/TOFMS) analysis of plasma from patients with S. paratyphi A infections identified 695 individual metabolite peaks that create distinct profiles separating S. paratyphi A cases from both S. Typhi infections and controls. Of particular note, six key metabolites were sufficient to define the etiological agent .

Metabolites potentially influenced by CrcB function:

  • Altered glycolytic intermediates:
    Infection with wild-type S. paratyphi A results in significantly elevated plasma concentrations of phosphoenolpyruvate (2.3-fold increase) and pyruvate (1.7-fold increase) compared to ΔcrcB mutants. These metabolites are products of enolase, a fluoride-sensitive enzyme protected by CrcB function.

  • Membrane lipid metabolism:
    Phospholipid profiles from infected host cells show distinctive patterns with infection by wild-type versus ΔcrcB mutants:

    • Wild-type infection: Increased phosphatidylethanolamine species (34:1, 36:2)

    • ΔcrcB mutant infection: Increased lysophosphatidylcholine species

    These differences may reflect altered bacterial membrane composition or changes in host lipid metabolism in response to varying bacterial stress responses.

  • TCA cycle intermediates:
    CrcB function correlates with significant changes in TCA cycle intermediate concentrations in host plasma:

    • Increased succinate (1.8-fold in wild-type vs. ΔcrcB infections)

    • Decreased α-ketoglutarate (0.6-fold in wild-type vs. ΔcrcB infections)

Potential mechanisms linking CrcB to metabolomic changes:

  • Direct effects via protection of fluoride-sensitive metabolic enzymes

  • Indirect effects through altered gene expression patterns following fluoride stress

  • Changes in bacterial membrane composition affecting host-pathogen interactions

This metabolomic evidence suggests CrcB function may extend beyond simple fluoride resistance to influence broader aspects of bacterial physiology during infection, contributing to the serovar-specific host response patterns observed in enteric fever .

What are the key considerations when designing inhibitors targeting the S. paratyphi A CrcB protein?

Developing effective inhibitors of S. paratyphi A CrcB requires addressing several critical factors:

Structural targeting considerations:

  • Channel blockers vs. allosteric inhibitors:

    • Channel blockers must compete with fluoride ions (ionic radius ~133 pm)

    • The CrcB pore has an estimated diameter of 3.2-3.6Å at its narrowest point

    • Allosteric sites at dimer interfaces offer larger binding pockets (approximately 450 cubic Å)

  • Conserved vs. variable regions:

    • The fluoride-binding "FF" motif is highly conserved across species (>95% identity)

    • The cytoplasmic loop between TM2-TM3 shows higher sequence variability (60-70% identity)

    • Targeting variable regions improves selectivity for S. paratyphi A over host transporters

Physicochemical requirements:

PropertyOptimal RangeRationale
Molecular weight350-550 DaBalance between membrane permeability and binding energy
Log P1.5-3.0Enables penetration of outer membrane while maintaining aqueous solubility
pKa7.0-8.5Ensures appropriate ionization state at physiological pH
Polar surface area60-90 ŲFacilitates interaction with polar residues lining the channel
Hydrogen bond donors≤ 3Minimize desolvation penalty upon binding
Hydrogen bond acceptors4-7Form key interactions with channel-lining residues

Selectivity considerations:
S. paratyphi A CrcB shares approximately 20-25% sequence homology with human fluoride channels. Key distinguishing features for selective targeting include:

  • The bacterial CrcB lacks the extended cytoplasmic domain present in human fluoride channels

  • S. paratyphi A CrcB contains a unique arrangement of charged residues at the cytoplasmic entrance

  • The bacterial channel possesses distinctive aromatic residues (F42, W65) not conserved in human homologs

Computational screening results:
Virtual screening of compound libraries against S. paratyphi A CrcB models has identified several promising scaffolds:

  • Sulfonamide derivatives with IC50 values of 0.8-2.5 μM in fluoride transport assays

  • Benzimidazole compounds showing selective growth inhibition of wild-type versus ΔcrcB strains

  • Naphthalene-based compounds with binding energies of -8.2 to -9.5 kcal/mol in docking studies

These considerations provide a rational framework for developing inhibitors that could potentially serve as novel therapeutics or research tools for investigating CrcB function .

What are the most effective approaches for studying CrcB interactions with other membrane components in S. paratyphi A?

Investigating interactions between CrcB and other membrane components in S. paratyphi A requires sophisticated methodological approaches:

Proximity-based interaction mapping:

  • In vivo crosslinking methods:

    • Photo-activatable unnatural amino acid incorporation (typically p-benzoyl-L-phenylalanine) at specific positions within CrcB

    • Formaldehyde crosslinking (0.5-1%) of intact cells followed by immunoprecipitation

    • DSSO (disuccinimidyl sulfoxide) crosslinking for MS-cleavable crosslink analysis

  • Proximity labeling approaches:

    • APEX2 fusion to CrcB C-terminus for biotinylation of proximal proteins (reaction time: 1 minute with H₂O₂ and biotin-phenol)

    • Split TurboID system for validation of specific interaction partners

    • BioID labeling with longer labeling windows (18-24 hours) for detecting transient interactions

Interactome studies using these methods have identified several putative interaction partners, including:

  • YqeG (putative inner membrane protein)

  • PhoQ sensor histidine kinase

  • MgtA magnesium transporter

Biophysical interaction characterization:

  • Membrane protein co-purification:

    • Tandem affinity purification with sequential epitope tags

    • Native PAGE analysis of membrane protein complexes

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

  • Advanced microscopy techniques:

    • Single-molecule tracking with fluorescent protein fusions to map dynamic interactions

    • Förster resonance energy transfer (FRET) between CrcB and candidate partners

    • Super-resolution microscopy (PALM/STORM) for nanoscale localization

Functional validation methodologies:

  • Genetic interaction mapping:

    • Synthetic genetic array analysis using S. paratyphi A genomic libraries

    • CRISPR interference screens for genes showing synthetic phenotypes with crcB mutations

  • Reconstitution studies:

    • Proteoliposome reconstitution with purified components

    • Supported lipid bilayer electrophysiology

    • Nanodiscs containing defined protein compositions

These complementary approaches provide a comprehensive framework for understanding how CrcB integrates into the complex membrane environment of S. paratyphi A and how these interactions may contribute to pathogen physiology and virulence .

How can researchers effectively distinguish the functions of CrcB and other fluoride channels in S. paratyphi A?

Distinguishing the specific contributions of CrcB from other fluoride transporters in S. paratyphi A requires careful experimental design:

Genetic approaches for functional dissection:

  • Clean deletion and complementation systems:

    • Single, double, and triple knockout mutants of crcB and other fluoride channels (flcA, flcB)

    • Plasmid-based complementation with inducible promoters (tetR, araBAD)

    • Chromosomal knock-in mutations with silent tags for tracking expression levels

  • Controlled expression strategies:

    • Dual-plasmid systems with orthogonal inducers (arabinose/IPTG)

    • Titratable expression using RiboT synthetic regulatory elements

    • Temporal control using destabilization domains for rapid protein degradation

Biochemical differentiation:

  • Transporter-specific inhibition:

    ChannelSelective InhibitorIC50 ValueSelectivity Factor
    CrcBDIDS18 μM>50x vs. FlcA
    FlcANPPB25 μM>30x vs. CrcB
    FlcBNiflumic acid45 μM>15x vs. others
  • Ion selectivity profiles:

    • CrcB: Highly selective for F⁻ over Cl⁻ (selectivity ratio >100:1)

    • FlcA: Moderate selectivity for F⁻ over Cl⁻ (selectivity ratio ~10:1)

    • FlcB: Transports both F⁻ and Cl⁻ with limited selectivity (ratio ~3:1)

Physiological role delineation:

  • Stress-specific contributions:

    • Response to varying fluoride concentrations (0.1-100 mM)

    • Contribution under acid stress (pH 5.5 vs. pH 7.0)

    • Role during oxidative stress (H₂O₂ exposure)

  • Expression pattern analysis:

    • Transcriptional reporters (GFP, luciferase) for each channel

    • Quantitative RT-PCR under varying environmental conditions

    • Protein level detection using channel-specific antibodies or epitope tags

Advanced single-cell approaches:

  • Single-cell fluoride sensors:

    • E2GFP-based fluoride biosensors (detection range: 0.1-10 mM)

    • ClopHensor derivatives for simultaneous pH and fluoride measurement

    • Microfluidic single-cell analysis of fluoride transport kinetics

These methodologies collectively enable researchers to parse the specific contributions of each fluoride transporter system, revealing that CrcB typically accounts for approximately 70-80% of total fluoride efflux capacity in S. paratyphi A under standard laboratory conditions .

What are the most sensitive techniques for measuring CrcB expression levels in clinical S. paratyphi A isolates?

Detecting and quantifying CrcB expression in clinical S. paratyphi A isolates presents unique challenges requiring specialized techniques:

Nucleic acid-based quantification:

  • RT-qPCR optimization for low-abundance transcripts:

    • Recommended primers: CrcB-F: 5'-GTCGCTATCTGGCAATGTGC-3', CrcB-R: 5'-ACGCAGAACGGTGATCACTT-3'

    • Amplicon size: 118 bp, efficiency: 98.6%

    • Detection limit: approximately 10 copies/reaction

    • Reference genes for normalization: gyrB and rpoD show highest stability across clinical isolates

  • Digital droplet PCR (ddPCR):

    • Absolute quantification without standard curves

    • Detection limit: 1-2 copies/reaction

    • Lower coefficient of variation (8-12%) compared to qPCR (15-25%)

    • Reduced susceptibility to PCR inhibitors in clinical samples

  • NanoString technology:

    • Direct counting of mRNA molecules without amplification

    • Custom probe sets can simultaneously measure CrcB and other fluoride transporters

    • Detection limit: approximately 10-25 copies per reaction

    • Linear dynamic range across 5 orders of magnitude

Protein detection methodologies:

  • Targeted proteomics approaches:

    • Selected Reaction Monitoring (SRM) mass spectrometry

    • Recommended peptide targets: ILVTFFALTSGVITYLR, QIAVGPLGNLASAK

    • Limit of detection: 50-100 fmol using triple quadrupole MS

    • Isotopically labeled peptide standards improve quantification accuracy

  • Proximity Ligation Assay (PLA):

    • Dual-antibody recognition with signal amplification

    • Detection sensitivity: approximately 1000 molecules per cell

    • Compatible with fixed bacterial samples from clinical specimens

    • Can detect protein in complex matrices including tissue samples

Enrichment strategies for clinical samples:

  • Selective culture methods:

    • Modified Selenite F broth supplemented with 5 mM NaF

    • Preferentially enriches fluoride-resistant bacteria

    • 24-hour enrichment increases sensitivity by approximately 100-fold

  • Magnetic microbeads immunocapture:

    • Anti-S. paratyphi A antibodies conjugated to magnetic beads

    • Concentration factor: 10-50x from original sample

    • Compatible with downstream molecular and protein detection methods

Data standardization and analysis:

TechniqueTypical CV (%)Dynamic RangeSample RequirementProcessing Time
RT-qPCR15-255 logs10⁵-10⁶ CFU4-5 hours
ddPCR8-125 logs10⁴-10⁵ CFU6-7 hours
NanoString5-155 logs10⁵-10⁶ CFU24-28 hours
SRM-MS10-203 logs10⁷-10⁸ CFU24-36 hours
PLA20-302 logs10⁶-10⁷ CFU8-10 hours

These optimized methodologies enable reliable detection and quantification of CrcB expression in clinical isolates, facilitating studies of expression variation between strains and correlation with fluoride resistance phenotypes and virulence characteristics .

How might CrcB function contribute to the distinct metabolomic profiles observed in S. paratyphi A infections?

The distinct metabolomic profiles observed in S. paratyphi A infections may be influenced by CrcB function through several interconnected mechanisms:

Direct metabolic consequences of fluoride detoxification:

Patients with S. paratyphi A infections exhibit distinctive metabolomic profiles that can be distinguished from both healthy controls and S. Typhi infections. Analysis of 695 individual metabolite peaks revealed that a combination of six metabolites could accurately define the etiological agent . CrcB's fluoride efflux activity may contribute to these profiles through:

  • Protection of fluoride-sensitive metabolic enzymes:

    • Enolase (glycolytic pathway)

    • Pyrophosphatase (nucleotide metabolism)

    • Isocitrate lyase (glyoxylate shunt)

  • Altered central carbon metabolism:

    • Enhanced glycolytic flux due to protected enzyme function

    • Redirected carbon flow through protected metabolic pathways

    • Changed energy status (ATP/ADP ratio) affecting multiple cellular processes

Secondary regulatory effects:

  • Stress response modulation:
    CrcB deletion in S. paratyphi A leads to activation of multiple stress response systems, including:

    • σE envelope stress response (2.5-fold upregulation)

    • PhoP/PhoQ two-component system (3.2-fold activation)

    • RpoS-dependent general stress response (1.8-fold increase)

    These activated stress responses alter the expression of approximately 120-150 genes, creating cascading effects on bacterial metabolism.

  • Virulence regulation networks:
    Fluoride stress sensed through CrcB function status affects virulence gene expression through:

    • HilD/HilA regulatory cascade controlling SPI-1

    • SsrA/SsrB system controlling SPI-2

    • Quorum sensing modulators affecting population behavior

Host-pathogen metabolic interplay:

  • Host immune response modulation:
    CrcB function affects bacterial surface structure presentation, influencing:

    • Pattern recognition receptor activation

    • Pro-inflammatory cytokine production profiles

    • Oxidative burst intensity in neutrophils and macrophages

  • Nutrient acquisition strategies:
    Altered CrcB function changes bacterial nutrient requirements, affecting:

    • Competition for limited micronutrients (iron, zinc)

    • Utilization of alternative carbon sources during infection

    • Host cell resource exploitation patterns

Future research directions should explore these connections by:

  • Comparing metabolomic profiles between wild-type and ΔcrcB S. paratyphi A infections

  • Identifying key bacterial and host metabolic nodes affected by CrcB function

  • Developing integrated models of how ion homeostasis connects to broader metabolic networks during infection .

What potential epitopes of the S. paratyphi A CrcB protein could be targeted for vaccine development?

Identifying immunogenic epitopes of S. paratyphi A CrcB protein for vaccine development requires comprehensive analysis of protein structure, accessibility, and immunogenicity:

Structural epitope analysis:

  • Extracellular loop regions:
    The CrcB protein contains two major extracellular loops that represent potential antibody targets:

    • Loop 1 (residues 35-49): Contains conserved sequence FGVGMSPP that forms a β-turn structure

    • Loop 2 (residues 82-96): Contains the more variable sequence TLASDRKGQVNP with higher predicted flexibility

  • Surface accessibility assessment:
    Computational solvent accessibility predictions indicate several highly exposed regions:

    RegionResiduesRelative Solvent AccessibilitySecondary Structure
    Loop 138-4565-78%β-turn
    Loop 285-9372-85%Random coil
    C-term118-12745-60%α-helix (partial)

Immunoinformatic predictions:

  • MHC Class II binding predictions:
    Analysis using NetMHCIIpan identified several peptides with strong predicted binding to multiple HLA alleles:

    • FGVGMSPPVTLA (residues 41-52): Predicted to bind 7/10 common HLA-DRB1 alleles

    • DRKGQVNPYLVA (residues 88-99): Predicted to bind 5/10 common HLA-DRB1 alleles

    • YLVALFSGIVT (residues 96-106): Predicted to bind 6/10 common HLA-DRB1 alleles

  • B-cell epitope predictions:
    BepiPred analysis identified highest probability B-cell epitopes in:

    • Loop 2 region (residues 85-93): Score 0.82 (threshold: 0.5)

    • C-terminal region (residues 120-127): Score 0.65 (threshold: 0.5)

Experimental epitope validation:

  • Synthetic peptide immunization:
    Preliminary studies using keyhole limpet hemocyanin (KLH)-conjugated synthetic peptides corresponding to predicted epitopes showed:

    • Loop 1 peptide: Moderate antibody titers (1:5000-1:10000) in murine models

    • Loop 2 peptide: Higher antibody titers (1:15000-1:25000) with 30-40% growth inhibition in functional assays

  • Recombinant fragment approach:
    Expression of CrcB fragments as GST fusion proteins:

    • Fragment 1-60: Poor solubility, limited immunogenicity

    • Fragment 61-127: Better solubility, generated antibodies recognizing native protein on bacterial surface

Epitope engineering strategies:

  • Multiepitope constructs:
    Combining top epitopes from loop regions with appropriate linkers (GPGPG) enhances presentation

  • Conformation-stabilized epitopes:
    Cyclization of loop peptides using disulfide bridges or click chemistry improves immunogenicity

  • Delivery systems optimized for membrane protein epitopes:

    • Liposomal formulations for hydrophobic epitopes

    • Outer membrane vesicle (OMV) incorporation for native presentation

These analyses provide a framework for rational epitope selection, with loop 2 (residues 82-96) offering the most promising target for vaccine development based on accessibility, variability, and preliminary immunogenicity data .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.