Recombinant Salmonella paratyphi A Protein MgtC (mgtC)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Salmonella Paratyphi A Protein MgtC is a full-length, His-tagged protein expressed in Escherichia coli . It corresponds to the mgtC gene (UniProt ID: Q5PC53) encoded in Salmonella Pathogenicity Island 3 (SPI-3), which is conserved across Salmonella serovars .

ParameterDetails
Expression SystemE. coli
TagN-terminal His tag
Amino Acid Sequence231 residues (MEERMLMFPY...IHWCIDSQ)
Purity>90% (SDS-PAGE)
StorageTris/PBS buffer with 50% glycerol; -20°C/-80°C

Functional Roles in Pathogenesis

MgtC is a critical virulence factor with multifunctional roles:

  • Intracellular Survival: Required for replication in macrophages and growth under magnesium (Mg²⁺)-limiting conditions .

  • ATP Synthase Inhibition: Binds and inhibits F₁F₀ ATP synthase, reducing ATP levels to maintain cytoplasmic pH and slow bacterial growth .

  • Phosphate Transport Activation: Directly interacts with PhoR histidine kinase to upregulate phosphate uptake, a process essential for balancing virulence and persistence .

  • Anti-Virulence Regulation: Represses cellulose biosynthesis by lowering cyclic diguanylate (c-di-GMP) levels, preventing biofilm formation that could hinder host invasion .

Mechanism of Virulence Modulation

  • CigR Interaction: MgtC activity is antagonized by CigR, an anti-virulence protein that binds MgtC to prevent ATP synthase inhibition. Virulence functions initiate only when MgtC levels exceed CigR .

  • PhoP Stabilization: MgtC protects the PhoP transcriptional regulator from degradation, enhancing expression of SPI-3 virulence genes .

Hypervirulence Phenotype

  • Disruption of MgtC-mediated phosphate transport (e.g., via PhoR mutations) leads to hypervirulence in mice and reduced non-replicating bacterial populations in macrophages .

Regulatory Feedback

  • MgtR Peptide: Encoded in the mgtCB operon, MgtR promotes FtsH protease-mediated degradation of MgtC, creating a negative feedback loop to limit MgtC accumulation .

Applications in Research

  • ELISA Assays: Used to detect MgtC in pathogenicity studies or vaccine development .

  • Biochemical Studies: Employed to analyze interactions with PhoR, CigR, and ATP synthase .

  • Antibiotic Tolerance Research: MgtC’s role in reducing ATP levels links it to bacterial persistence mechanisms .

Limitations and Challenges

  • Instability: Recombinant MgtC requires storage at -80°C with glycerol to prevent aggregation .

  • Functional Redundancy: Overlapping roles with MgtB (Mg²⁺ transporter) complicate phenotype interpretation in knockout models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary based on purchasing method or location. Please contact your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipment is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mgtC; SPA3614; Protein MgtC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
mgtC
Target Protein Sequence
MEERMLMFPYILNLLAAMLLGALIGAERQWRQRMAGLRTNALVATGAAVFILSSMTTSPD SPGRIAAQIVSGIGFLGAGVIMREGMNVRGLNTAATLWCSAGIGVLCGLGQFKNALAATI IILCANILLREAAQRINQLPVSAEAEKRYILKVTCNKEDESAVRQWLLNIVKEAAICLQG LGSVPAQEQGYKEIRAELVGHADYRKTRELIISRIGDNDNITAIHWCIDSQ
Uniprot No.

Target Background

Function
MgtC is a virulence factor essential for growth in low Mg(2+) environments and intracellular survival within macrophages. It may be involved in regulating membrane potential by activating Na(+)/K(+)-ATPase.
Database Links

KEGG: spt:SPA3614

Protein Families
MgtC/SapB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MgtC protein and what is its role in Salmonella pathogenesis?

MgtC is a virulence factor common to several intracellular pathogens, including Salmonella enterica, where it plays a crucial role in intramacrophage survival and growth in magnesium-depleted environments. In Salmonella, MgtC confers virulence through two distinct mechanisms. First, it inhibits the bacterial F₁F₀ ATP synthase, which enables the bacterium to maintain cytoplasmic pH near 7 when experiencing acidic conditions inside macrophages and to reduce transcription of ribosomal rRNA when cytosolic conditions prevent functional ribosome assembly . Second, MgtC prevents degradation of PhoP, a master regulator of Salmonella pathogenesis, thereby enhancing virulence gene expression . These functions collectively commit Salmonella to a state of low cytosolic ATP, slow growth, and expression of genes requiring large amounts of the PhoP regulator .

The significance of MgtC in pathogenesis is underscored by its conservation across multiple intracellular pathogens, where it mediates intramacrophage survival and proliferation within host tissues . This conservation suggests that MgtC represents a common strategy employed by various bacterial pathogens to adapt to the challenging environment within host cells.

How is MgtC gene expression regulated in Salmonella?

MgtC expression in Salmonella is controlled through a sophisticated regulatory network involving multiple mechanisms operating at different levels. At the transcriptional level, the mgtC gene is part of the mgtCBR operon, which is highly induced under low magnesium conditions through the PhoP/PhoQ two-component system and during macrophage infection .

Despite strong transcriptional induction under specific conditions, MgtC protein levels are tightly regulated through several post-transcriptional and post-translational mechanisms:

  • MgtR peptide regulation: A small hydrophobic peptide encoded within the mgtCB operon promotes MgtC degradation by the FtsH protease, establishing a negative feedback loop . This mechanism provides precise control over MgtC protein abundance, ensuring it only accumulates when needed.

  • CigR protein inhibition: The anti-virulence protein CigR binds directly to MgtC, preventing it from inhibiting the F₁F₀ ATP synthase . The cigR gene is located on Salmonella pathogenicity island 3 (SPI-3) in the same transcription unit as mgtC under inducing conditions, but is also transcribed constitutively and independently of MgtC . This dual transcription pattern establishes a threshold of CigR protein that MgtC must exceed to exert its virulence functions.

  • AmgR antisense RNA control: This RNA is complementary to the mgtC portion of the mgtCBRcigR polycistronic mRNA and contributes to regulating MgtC expression .

This multilayered regulatory system ensures precise control of MgtC protein levels, preventing premature or inappropriate activation of MgtC-dependent virulence programs that would commit the bacterium to a low-ATP, slow-growth state .

How does the temporal dynamics of MgtC and CigR expression affect experimental outcomes?

What experimental designs are optimal for studying MgtC function?

Several experimental designs are particularly valuable for investigating MgtC function:

  • Time-course experiments: Given the complex temporal dynamics of MgtC and its regulators, time-course studies that sample at multiple timepoints after induction are essential to capture the full spectrum of MgtC-dependent phenotypes . These experiments should examine protein levels (MgtC, CigR, AtpB) and functional outcomes (ATP levels, intramacrophage survival) over time.

  • Genetic manipulation studies: Comparing wild-type strains with various mutants (mgtC deletion, cigR deletion, mgtC cigR double mutant, cigR promoter mutant) provides insights into the relationships between these genes . The finding that an mgtC cigR double mutant retains the behavior of the mgtC single mutant supports the model that CigR functions primarily by inhibiting MgtC .

  • Plasmid complementation and overexpression: Expressing genes from heterologous promoters can help dissect their functions. For example, a plasmid expressing the cigR gene from a heterologous promoter increases ATP levels in wild-type Salmonella but not in an mgtC mutant, indicating that CigR exerts its effects by targeting MgtC .

  • Solomon Four Group Design: For complex studies examining the effects of experimental manipulation and testing, this design pairs a post-test only design with a pre-test post-test design . This approach enables researchers to determine whether pre-testing influences results and to control for maturation and history effects .

  • Protein-protein interaction assays: Bacterial two-hybrid assays have been used successfully to demonstrate interactions between MgtC and regulatory proteins like MgtR . These assays can identify mutant derivatives that prevent both regulation and interaction between partners.

  • Macrophage infection models: Assessing intramacrophage survival of wild-type and mutant strains provides insights into MgtC function during infection . Overexpression of MgtR peptide in wild-type Salmonella reduces bacterial replication in macrophages, highlighting how altering MgtC regulation affects virulence .

These diverse experimental approaches collectively enable researchers to comprehensively investigate MgtC function and regulation across different conditions and timepoints.

How do the regulatory mechanisms of MgtC affect experimental design considerations?

The multiple regulatory mechanisms controlling MgtC expression and function present significant implications for experimental design:

  • Timing considerations: The three negative regulators of MgtC (CigR, MgtR, and AmgR) operate at different stages of the MgtC expression timeline . CigR is present before MgtC and controls the onset of MgtC-dependent activities, whereas MgtR and AmgR, being made after MgtC, control the duration of MgtC presence . This temporal sequence must be considered when designing experiments, particularly for time-sensitive phenotypes.

  • Strain selection: The absence of certain regulatory elements in different bacterial species can affect experimental outcomes. For example, MgtR is conserved in Salmonella enterica serovars but not found in other bacterial species encoding MgtC . This species-specific regulation means that findings from one bacterial species may not generalize to others.

  • Control selection: Appropriate genetic controls are essential for interpreting MgtC-related phenotypes. The mgtC cigR double mutant provides a critical control showing that CigR works primarily by inhibiting MgtC, as this double mutant retains the behavior of the mgtC single mutant in phenotypes such as intramacrophage survival and ATP levels .

  • Protein abundance considerations: Despite high transcriptional induction of the mgtCB operon under magnesium-depleted conditions, the MgtC protein is barely detectable in wild-type Salmonella strains due to regulatory mechanisms . This discrepancy between transcript and protein levels necessitates protein-level analysis rather than relying solely on transcriptional data.

  • In vivo relevance assessment: Proteomic analysis of Salmonella isolated from macrophages identified MgtB but not MgtC, suggesting that intracellular MgtC levels are low or expression occurs at specific infection timepoints not captured in the analysis . This highlights the importance of examining multiple timepoints during infection studies.

Understanding these regulatory mechanisms is crucial for designing experiments that can effectively isolate MgtC-specific effects from those resulting from its complex regulatory network.

What methodological approaches are recommended for studying MgtC-protein interactions?

Several methodological approaches are particularly effective for investigating MgtC-protein interactions:

  • Bacterial two-hybrid assays: These assays have successfully demonstrated direct interactions between MgtC and regulatory proteins like MgtR . They allow for the identification of specific interaction domains through the analysis of mutant derivatives.

  • Co-immunoprecipitation: This technique can isolate protein complexes containing MgtC from bacterial lysates, enabling the identification of interacting partners under native conditions. Special consideration must be given to detergent selection and extraction conditions due to MgtC's membrane localization.

  • Direct binding assays with purified components: Using purified recombinant His-tagged MgtC protein in combination with potential binding partners allows for the assessment of direct interactions . This approach is particularly valuable for determining binding affinities and kinetics.

  • Mutational analysis: Creating mutant derivatives of MgtC and testing their ability to interact with known partners can identify specific residues or domains critical for protein-protein interactions. This approach has been used to identify MgtR mutants that prevent both regulation and interaction with MgtC .

  • Cross-linking studies: Chemical cross-linking can stabilize transient protein-protein interactions for subsequent analysis by mass spectrometry or western blotting, which is particularly useful for membrane protein complexes.

  • Functional assays with interaction mutants: Testing the functional consequences of mutations that disrupt specific interactions provides insights into the physiological relevance of those interactions. For example, MgtR mutants that fail to interact with MgtC also fail to regulate MgtC degradation .

When studying MgtC interactions, researchers should consider that different interactions may occur under different conditions or at different timepoints, necessitating comprehensive analysis across various experimental conditions.

How can researchers distinguish between direct and indirect effects of MgtC?

Distinguishing direct from indirect effects of MgtC represents a significant challenge, but several approaches can help:

  • Temporal resolution studies: High-resolution time-course experiments can establish cause-and-effect relationships, as direct effects of MgtC should manifest shortly after MgtC expression exceeds CigR levels, while indirect effects may emerge later .

  • In vitro reconstitution: Using purified components in controlled biochemical assays can establish direct effects. If MgtC directly inhibits ATP synthase, this inhibition should be observable in a reconstituted system with purified components.

  • Structure-function analysis: Creating specific MgtC variants with targeted mutations and assessing their impact on different phenotypes can identify domains directly involved in particular functions.

  • Epistasis analysis: Comparing phenotypes of single and double mutants helps establish the order of gene action. The finding that an mgtC cigR double mutant behaves like an mgtC single mutant supports that CigR acts directly on MgtC rather than through alternate pathways .

  • Protein-protein interaction verification: Demonstrating physical interaction between MgtC and a putative target provides evidence for direct effects. The interaction between MgtR and MgtC verified by bacterial two-hybrid assays supports a direct regulatory relationship .

  • Consistency across experimental systems: Effects observed consistently across multiple experimental systems (in vitro, cell culture, animal models) are more likely to represent direct consequences of MgtC function.

An illustrative example from the literature demonstrates how these approaches can be combined: the cigR mutant produces more PhoP-activated mRNAs than wild-type Salmonella, reflecting that MgtC protects PhoP from degradation . When CigR is absent, higher amounts of free MgtC further enhance PhoP-dependent gene transcription . This represents an indirect effect of MgtC on gene expression mediated through its direct effect on PhoP stability.

What experimental methods are recommended for measuring MgtC activity?

Several experimental methods can effectively measure MgtC activity in different contexts:

  • ATP level measurements: Since MgtC inhibits ATP synthase, measuring cellular ATP levels using luciferase-based assays provides a quantitative readout of MgtC activity . Comparing ATP levels in wild-type, mgtC mutant, and regulatory mutant strains under various conditions can reveal MgtC-dependent effects. Time-course measurements are particularly valuable, as differences in ATP levels between wild-type and mutant strains emerge only after MgtC protein levels exceed CigR levels (around 5 hours post-induction) .

  • Intramacrophage survival assays: MgtC is required for intramacrophage survival, making this a relevant functional readout . Colony-forming unit (CFU) assays at different timepoints post-infection can quantify the impact of MgtC and its regulators on bacterial survival and replication within macrophages. Overexpression of the MgtR peptide in wild-type Salmonella reduces bacterial replication in macrophages, demonstrating how altering MgtC regulation affects this phenotype .

  • Growth assays in magnesium-depleted medium: MgtC is required for growth in magnesium-depleted conditions, providing another functional readout . Growth curves in defined media with varying magnesium concentrations can reveal MgtC-dependent growth phenotypes.

  • PhoP stability assays: Since MgtC prevents PhoP degradation, measuring PhoP protein levels by western blotting can indirectly assess MgtC activity . The cigR mutant produces more PhoP-activated mRNAs than wild-type Salmonella, reflecting higher PhoP levels due to increased free MgtC .

  • pH homeostasis measurements: MgtC helps maintain cytoplasmic pH near 7 in acidic environments . pH-sensitive fluorescent probes can measure internal pH in bacterial cells under different conditions to assess this MgtC function.

When designing these assays, researchers should carefully consider the temporal dynamics of MgtC expression and regulation, as well as the specific conditions that induce MgtC expression, such as low magnesium and acidic pH.

What are the key challenges in interpreting MgtC functional data?

Interpreting functional data related to MgtC presents several challenges that researchers must address:

  • Temporal complexity: The threshold effect created by the CigR-MgtC relationship means that MgtC-dependent phenotypes manifest only when MgtC protein levels exceed CigR levels . This temporal complexity can lead to misleading interpretations if sampling is limited to a single timepoint. For example, ATP level measurements at 3 hours post-induction show no difference between wild-type and mgtC mutant strains, whereas significant differences emerge by 5 hours .

  • Low protein abundance: Despite high transcriptional induction of the mgtC gene, MgtC protein is hardly detectable in wild-type Salmonella due to multiple negative regulatory mechanisms . This discrepancy between transcript and protein levels complicates interpretation of transcriptional data without corresponding protein analysis.

  • Multiple regulatory layers: The multiple layers of regulation controlling MgtC (CigR, MgtR, AmgR) make it challenging to isolate direct MgtC effects from those involving its regulators . Careful genetic analysis with appropriate controls is needed to disentangle these effects.

  • Species-specific regulation: Some regulatory mechanisms, such as MgtR, are not conserved across all bacteria expressing MgtC, limiting the generalizability of findings between species . Researchers should be cautious when extrapolating regulatory mechanisms from one bacterial species to another.

  • In vivo relevance: Despite the mgtCB operon being highly induced in macrophages, proteomic analysis of Salmonella isolated from macrophages identified MgtB but not MgtC . This suggests either that intracellular MgtC levels remain low due to regulatory mechanisms or that MgtC expression occurs at specific infection timepoints not captured in the analysis.

To address these challenges, researchers should employ time-course experiments, multiple complementary techniques, appropriate genetic controls, and careful consideration of the specific conditions and bacterial species being studied.

How does the experimental design affect the interpretation of MgtC regulation data?

The choice of experimental design significantly impacts the interpretation of MgtC regulation data in several ways:

To maximize the reliability and interpretability of MgtC regulation data, researchers should employ comprehensive experimental designs that capture temporal dynamics, include appropriate genetic controls, and consider the specific conditions under which MgtC function is being assessed.

Table: Comparison of MgtC Regulatory Mechanisms in Salmonella

Regulatory FactorMechanism of ActionTiming of ExpressionEffect on MgtCConservation
CigR proteinBinds MgtC, preventing inhibition of F₁F₀ ATP synthaseConstitutively expressed; also co-transcribed with mgtCSets threshold MgtC must exceed to functionFound in Salmonella
MgtR peptidePromotes MgtC degradation by FtsH proteaseCo-expressed with MgtC under inducing conditionsControls duration of MgtC activityConserved in Salmonella enterica serovars but not other bacterial species
AmgR antisense RNAComplementary to mgtC portion of polycistronic mRNATranscribed under PhoP-dependent conditionsPost-transcriptional regulation of MgtCFound in Salmonella

This table summarizes the key regulatory mechanisms controlling MgtC expression and function in Salmonella . The temporal and mechanistic differences between these regulators create a sophisticated system that precisely controls when and how MgtC exerts its effects on bacterial physiology and virulence.

Table: Temporal Dynamics of MgtC Function After Induction

Time Post-InductionMgtC:CigR Protein RatioATP Levels in Wild-Type vs. mgtC MutantATP Levels in Wild-Type vs. cigR MutantKey Observations
0-3 hoursCigR > MgtC (>20× higher)SimilarSimilarMgtC expression beginning; insufficient to overcome CigR threshold
4 hoursMgtC > CigRBeginning to divergeBeginning to divergeMgtC levels exceed CigR; functional effects emerging
5+ hoursMgtC >> CigRSignificantly differentSignificantly different (cigR mutant has lower ATP)Full manifestation of MgtC-dependent phenotypes

This table illustrates the temporal dynamics of MgtC protein expression relative to CigR and the corresponding functional consequences observed in ATP levels . This threshold effect demonstrates why timing is critical in experimental design and interpretation when studying MgtC function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.