Recombinant Salmonella paratyphi A Putative 2-aminoethylphosphonate transport system permease protein phnU (phnU)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
phnU; SPA2296; Putative 2-aminoethylphosphonate transport system permease protein PhnU
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
phnU
Target Protein Sequence
MSLILPLEKPALNLRPLLWLLLPLLVLATLFFWPLSLIVEQALRGANGEIGLETFRQVVD SKRFVGALLNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSELIGRVVDTFIALPTFLIT LAFTFIYGSAGLLNGALMSLFAFELPPVDFLYSMQGVILAEITVFTPLVMRPLMAALRQI DKSQLEAASILGAHPLRVIGQVIFPAALPALMAGGSLCLLLTTNEFGIVLFIGAKGVNTL PMMVYSKAILESDYTVACMIALINIVLSLGLFSLYRLAASRTGVRSQPC
Uniprot No.

Target Background

Function
This protein is likely part of the PhnSTUV complex (TC 3.A.1.11.5) involved in 2-aminoethylphosphonate import. It is believed to be responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: spt:SPA2296

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the PhnU protein in Salmonella paratyphi A and what is its functional significance?

PhnU is a transmembrane permease component of the PhnSTUV ABC-transport system involved in 2-aminoethylphosphonate (2-AEP) uptake in Salmonella paratyphi A. This protein forms part of the second identified 2-AEP transport system (the first being part of the C-P lyase operon phnCDEFGHIJKLMNOP) . As a component of an ABC-transporter, PhnU works in conjunction with a periplasmic substrate-binding protein, an ATP-binding domain protein, and other transmembrane domains to facilitate phosphonate compound transport across the bacterial membrane.

The functional significance of PhnU lies in its role in phosphonate metabolism, which has implications for bacterial survival in phosphate-limited environments. The PhnSTUV system, including PhnU, has been shown to complement C-P lyase knockout mutants of E. coli, demonstrating its importance in alternative phosphorus acquisition pathways .

How does PhnU relate to other transport systems in Salmonella species?

PhnU represents one component of specialized transport machinery that differs from the primary phosphonate transport system associated with the C-P lyase pathway. Unlike the PhnCDE transport system (located within the phnCDEFGHIJKLMNOP operon), the PhnSTUV system represents an alternative mechanism for 2-AEP uptake .

In the broader context of Salmonella transport systems, PhnU shares functional similarities with other membrane permeases involved in nutrient acquisition but is specifically adapted for phosphonate compound transport. This specialization is part of the bacterial strategy to utilize diverse phosphorus sources, particularly in environments where inorganic phosphate is limited.

What expression systems are most effective for producing recombinant PhnU protein?

For recombinant PhnU expression, several systems have demonstrated efficacy with similar transmembrane proteins:

E. coli Expression Systems:

  • BL21(DE3) strains show good expression levels when the phnU gene is cloned into vectors containing T7 promoters (pET series vectors)

  • C41(DE3) and C43(DE3) strains are recommended for membrane proteins like PhnU as they are engineered to handle potentially toxic membrane protein overexpression

Expression Protocol Optimization:

  • Clone the phnU gene with a C-terminal His-tag for purification

  • Transform into expression hosts

  • Induce with low IPTG concentrations (0.1-0.3 mM) at lower temperatures (16-20°C)

  • Consider codon optimization for the S. paratyphi A sequence for improved expression in E. coli

Similar to other membrane proteins, recombinant PhnU should be extracted using detergent solubilization methods, with detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) showing efficacy for similar ABC transporter components .

What methods can be used to assess the function of recombinant PhnU in vitro?

Spectrophotometric Coupling Assays:
Similar to the methods described for studying other phosphonate-metabolizing enzymes, PhnU function can be assessed through coupling assays that monitor substrate transport :

  • Substrate Uptake Assays: Using radiolabeled or fluorescently-labeled 2-AEP to track transport into proteoliposomes containing reconstituted PhnU with its partner proteins

  • ATPase Activity Coupling: Monitoring ATP hydrolysis (which drives transport) through coupled enzymatic reactions measuring NADH oxidation at 340 nm

  • Transport Kinetics Measurement: Determining kinetic parameters (Km, Vmax) through time-course uptake experiments with varying substrate concentrations

Reconstitution Protocol:

  • Purify recombinant PhnU along with other PhnSTUV components

  • Reconstitute into proteoliposomes using lipid mixtures that mimic bacterial membranes

  • Perform transport assays by adding labeled substrate to the external buffer

  • Quantify internal substrate accumulation through filtration and scintillation counting or fluorescence measurement

How can protein-protein interactions between PhnU and other transport system components be characterized?

Experimental Methods for Characterizing PhnU Interactions:

  • Pull-Down Assays: Using His-tagged PhnU to identify interacting partners like PhnS, PhnT, and PhnV

  • Bacterial Two-Hybrid (B2H) Systems: For initial screening of protein-protein interactions

  • Surface Plasmon Resonance (SPR): For quantitative binding kinetics between PhnU and other components

  • Structure-Based Prediction Tools: Similar to those described in source , which mentions "Structure-based prediction of protein-protein interactions" can reveal the approximate locations of potential interfaces

Data Analysis Approach:
Interaction data can be analyzed using Bayesian networks similar to those described in , which notes: "The five empirical scores are combined using a Bayesian network to yield a likelihood ratio (LR) that a candidate protein-protein complex represents a true interaction."

What is the potential significance of PhnU as a vaccine target against Salmonella paratyphi A?

PhnU, as a membrane protein in S. paratyphi A, represents a potential vaccine target, although it has not been specifically evaluated in the literature provided. The research on S. paratyphi A vaccine development has focused on other antigens:

Tested S. paratyphi A AntigensProtection RateImmune ResponseReference
Outer membrane protein LamB95%Humoral and cellular
Outer membrane protein PagC95%Humoral and cellular
Outer membrane protein TolC85%Humoral and cellular
Outer membrane protein NmpC80%Humoral and cellular
Outer membrane protein FadL70%Humoral and cellular
SptP deletion mutantFull protection*Cellular and humoral
CVD 1902 (ΔguaBA ΔclpX mutant)N/ACell-mediated

*Against lethal intraperitoneal challenge

As an integral membrane protein involved in phosphonate transport, PhnU could potentially be explored as a vaccine candidate using similar approaches to those employed for other outer membrane proteins of S. paratyphi A. The experience with other membrane proteins suggests that recombinant PhnU could elicit protective immune responses if properly formulated and administered .

How might PhnU contribute to Salmonella paratyphi A virulence and pathogenesis?

While the direct role of PhnU in S. paratyphi A virulence has not been explicitly characterized in the provided literature, its function in phosphonate transport could contribute to pathogenesis in several ways:

  • Nutrient Acquisition During Infection: PhnU may enable the bacterium to utilize alternative phosphorus sources within the host environment, particularly in phosphate-limited niches

  • Metabolic Adaptation: The ability to transport and metabolize phosphonates could provide metabolic flexibility during infection

  • Potential Role in Stress Responses: Phosphonate metabolism has been linked to bacterial stress responses, which are crucial during host colonization

To determine PhnU's specific contribution to virulence, researchers could employ methodologies similar to those used for studying other S. paratyphi A virulence factors, such as:

  • Creating phnU deletion mutants and assessing virulence in animal models

  • Evaluating expression levels of phnU during different stages of infection

  • Determining if phnU is upregulated under host-mimicking conditions

What structural features determine PhnU substrate specificity and transport mechanism?

As a transmembrane permease component of an ABC transporter, PhnU likely contains multiple membrane-spanning domains that form a channel for 2-AEP translocation. Based on studies of similar ABC transporter permeases:

Predicted Key Structural Elements:

  • Transmembrane Helices: Typically 6-10 membrane-spanning alpha-helical segments

  • Substrate-Binding Pocket: Specific residues that interact with 2-AEP

  • Coupling Interface: Regions that interact with the ATP-binding protein (PhnT) to couple ATP hydrolysis to transport

  • Oligomerization Domains: Surfaces that mediate interaction with other system components

Research Methodologies for Structural Analysis:

  • Cryo-EM Analysis: For determining the three-dimensional structure of the complete PhnSTUV complex

  • Site-Directed Mutagenesis: To identify critical residues for substrate binding and translocation

  • Molecular Dynamics Simulations: To model the transport cycle and substrate passage

  • Cross-Linking Studies: To capture different conformational states during the transport cycle

How can transcriptomic and proteomic approaches be used to study PhnU regulation?

Transcriptomic Approaches:

  • RNA-Seq Analysis: To determine conditions that induce phnU expression, particularly comparing phosphate-rich vs. phosphate-limited conditions

  • qRT-PCR: For targeted quantification of phnU transcript levels

  • Promoter-Reporter Fusions: To visualize phnU expression in different environments

Proteomic Approaches:

  • Western Blotting: To quantify PhnU protein levels using specific antibodies

  • Mass Spectrometry: For global proteomic analysis to identify co-regulated proteins

  • Protein Turnover Studies: To determine PhnU stability and degradation rates

Integrated Analysis Strategy:
Combine transcriptomic and proteomic data with metabolomic analysis of phosphonate utilization to create a comprehensive model of PhnU regulation and function. This approach would be similar to the "immunoproteomic technology" mentioned in that was used to screen outer membrane proteins of S. paratyphi A.

What PCR-based methods can be used to detect and quantify the phnU gene in Salmonella paratyphi A isolates?

PCR Detection Protocol:
Based on methodologies similar to those described in for Salmonella detection:

  • PCR Reaction Setup (25 μL):

    • 2.5 U high-fidelity Taq Polymerase

    • 1× Buffer with 15 mM MgCl₂

    • 0.24 mM dNTPs

    • phnU-specific primers (0.16-0.25 μM)

    • 5 μL template DNA

  • DNA Extraction Methods:

    • BAX System lysis protocol: 5 μL culture in 200 μL lysis reagent, incubate at 37°C for 20 min followed by 95°C for 10 min

    • Proteinase K method: 5 μL culture with 150 μL PK-lysis buffer (1× TE pH 8.0 with 5 μL proteinase K at 20 mg/mL), incubate at 95°C for 15 min

  • PCR Program:

    • Initial denaturation: 95°C for 5 min

    • 30 cycles: 95°C for 30 sec, 55-60°C for 30 sec, 72°C for 1 min/kb

    • Final extension: 72°C for 7 min

  • Quantitative PCR Considerations:

    • Use SYBR Green or TaqMan chemistry for quantification

    • Include standard curves using known copy numbers of cloned phnU

    • Normalize to reference genes for relative quantification

How can the expression and localization of PhnU in Salmonella paratyphi A be visualized?

Immunofluorescence Microscopy Protocol:

  • Fix bacterial cells with 4% paraformaldehyde

  • Permeabilize with lysozyme and Triton X-100

  • Block with BSA solution

  • Incubate with anti-PhnU primary antibody

  • Apply fluorophore-conjugated secondary antibody

  • Counterstain membrane with appropriate dyes

  • Visualize using confocal microscopy

Protein Fusion Approaches:

  • Generate chromosomal fusions of phnU with fluorescent protein genes (e.g., GFP, mCherry)

  • Ensure fusions maintain protein function through complementation testing

  • Visualize live cells under different growth conditions

  • Quantify fluorescence intensity to measure expression levels

Western Blot Analysis:
Fractionate bacterial cells to separate cytoplasmic, membrane, and periplasmic compartments, then perform Western blotting using PhnU-specific antibodies to confirm proper membrane localization and expression levels.

How does PhnU in Salmonella paratyphi A compare to homologous proteins in other bacterial species?

Comparative Analysis Framework:

  • Sequence Alignment: Perform multiple sequence alignments of PhnU homologs from diverse bacterial species

  • Phylogenetic Analysis: Construct phylogenetic trees to understand evolutionary relationships

  • Domain Conservation: Identify conserved functional domains and variable regions

  • Structure Prediction: Use homology modeling to predict structural differences

Expected Findings Based on Literature:

  • PhnU likely shares significant homology with other ABC transporter permeases involved in phosphonate transport

  • Functional domains involved in substrate recognition and transport are expected to be conserved

  • Species-specific variations may reflect adaptation to different phosphonate compounds available in diverse ecological niches

What bioinformatic approaches can predict PhnU substrate specificity and functional partners?

Bioinformatic Methodologies:

  • Sequence-Based Predictions:

    • Motif identification for substrate binding

    • Conservation analysis of residues lining the predicted transport channel

    • Machine learning approaches trained on known ABC transporter specificities

  • Structural Modeling:

    • Homology modeling based on crystal structures of related transporters

    • Molecular docking of potential substrates

    • Molecular dynamics simulations to assess substrate passage

  • Protein-Protein Interaction Prediction:

    • Co-evolution analysis to identify functional partners

    • Structure-based prediction methods as described in : "The accuracy and range of applicability of PrePPI, and the crucial role of structural modeling, were unanticipated, but should not come as a complete surprise. Most protein complexes in the PDB have structural neighbors that share binding properties, and protein interface space may well be close to 'complete' in terms of the packing orientations of secondary structure elements."

  • Genomic Context Analysis:

    • Examination of gene neighborhood conservation

    • Operon structure comparison across species

    • Co-occurrence patterns of phnU with other genes

What are the most promising approaches for developing inhibitors targeting PhnU function?

Inhibitor Development Strategies:

  • Structure-Based Drug Design:

    • Utilizing structural information to design molecules that block the substrate-binding site

    • Developing compounds that disrupt PhnU interaction with other transport components

    • Creating allosteric inhibitors that lock PhnU in an inactive conformation

  • High-Throughput Screening:

    • Developing fluorescence-based transport assays suitable for screening compound libraries

    • Creating bacterial growth assays in phosphonate-only media to identify potential inhibitors

    • Designing whole-cell reporter systems that signal when PhnU function is compromised

  • Peptide-Based Inhibitors:

    • Designing peptides that mimic interaction interfaces between PhnU and other system components

    • Developing cyclic peptides that target the substrate translocation pathway

  • Antibody-Based Approaches:

    • Generating antibodies against extracellular loops of PhnU to block transport function

    • Developing antibody-drug conjugates targeting PhnU-expressing bacteria

How might CRISPR-Cas9 technology be applied to study PhnU function and regulation?

CRISPR-Cas9 Applications for PhnU Research:

  • Precise Gene Editing:

    • Creating clean phnU deletion mutants in S. paratyphi A

    • Introducing point mutations to study structure-function relationships

    • Generating reporter fusions at the native locus

  • Transcriptional Modulation:

    • Using CRISPR interference (CRISPRi) to downregulate phnU expression

    • Employing CRISPR activation (CRISPRa) to upregulate phnU expression

    • Temporal control of expression using inducible CRISPR systems

  • Screening Applications:

    • Pooled CRISPR screens to identify genes that interact with phnU

    • CRISPR scanning mutagenesis to identify critical residues

    • Multiplex CRISPR to simultaneously modify phnU and related genes

  • Protocol Considerations:

    • Delivery of CRISPR components via conjugation or electroporation

    • Use of temperature-sensitive plasmids for transient CRISPR expression

    • Confirmation of edits by sequencing and functional assays

What strategies can address low yield or insolubility of recombinant PhnU protein?

Troubleshooting Low Yield:

  • Expression Optimization:

    • Test multiple E. coli strains (BL21, C41, C43, Rosetta)

    • Vary induction parameters (IPTG concentration, temperature, duration)

    • Use auto-induction media for gentler expression

    • Test different fusion tags (His, MBP, SUMO) at N and C termini

  • Improving Solubility:

    • Screen detergents systematically (DDM, LMNG, CHAPS, Fos-choline)

    • Use mild solubilization conditions (lower temperature, gentle agitation)

    • Test co-expression with chaperones (GroEL/ES, DnaK/J)

    • Consider membrane scaffold proteins for nanodisc reconstitution

  • Purification Optimization:

    • Implement two-step purification (IMAC followed by size exclusion)

    • Include stabilizing agents (glycerol, specific lipids) in all buffers

    • Minimize time between steps to prevent aggregation

    • Consider on-column detergent exchange

Decision Flowchart for Troubleshooting:

  • First attempt yields insoluble protein → Try lower temperature, gentler induction

  • Protein still insoluble → Try different detergents and solubilization conditions

  • Soluble but low yield → Optimize expression strain and conditions

  • Purified protein unstable → Add stabilizers and optimize buffer composition

How can researchers address specificity challenges when studying PhnU in complex with other transport components?

Strategies for Ensuring Specificity:

  • Control Experiments:

    • Use negative controls lacking PhnU but containing all other components

    • Create non-functional PhnU mutants as negative controls

    • Perform competition assays with unlabeled substrates to demonstrate specificity

  • Component Isolation:

    • Study individual components before reconstituting the complete system

    • Use tagged versions of each protein to confirm presence in complexes

    • Employ size exclusion chromatography to verify proper complex formation

  • Functional Validation:

    • Demonstrate substrate specificity using structurally related compounds

    • Perform complementation assays in deletion strains

    • Use site-directed mutagenesis to confirm key residues for function

  • Data Validation Approaches:

    • Apply multiple orthogonal techniques to confirm findings

    • Use proper statistical analyses to assess significance

    • Implement concentration-dependent experiments to establish specificity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.