Recombinant Salmonella paratyphi A Putative 2-aminoethylphosphonate transport system permease protein phnV (phnV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
phnV; SPA2297; Putative 2-aminoethylphosphonate transport system permease protein PhnV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
phnV
Target Protein Sequence
MLIWSPKGRAAAGVVASVLFIVFFFLPLAVILMSSLSQQWNGILPSGFTLNHFVNALHGA AWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLSMVFYLPSAIPSVSVGLGI LVAFSQGPLQMNGTLWIVLTAHFVLISAFTFSNVSTGLARISADIENVASSLGASPWYRL RHVTLPLLMPWMVSALALSLSLSMGELGATVMIYPPGWTTLPVAIFSLTDRGNIADGAAL TIVLVAITLLLMMKLERIAKRLGQK
Uniprot No.

Target Background

Function
Likely a component of the PhnSTUV complex (TC 3.A.1.11.5) involved in the import of 2-aminoethylphosphonate. This protein is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: spt:SPA2297

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the current understanding of S. paratyphi A epidemiology and its significance for phnV research?

S. paratyphi A causes approximately one-quarter of the estimated 20 million enteric fever cases annually worldwide. Epidemiological evidence suggests an increasing proportion of enteric fever burden is attributable to S. paratyphi infection, highlighting the importance of research into its virulence factors and transport systems . When studying phnV, it's essential to consider that S. paratyphi A strains in Southern China have demonstrated significant genetic conservation, with sequence similarities ranging from 99.31% to 99.88% for key genes, suggesting potential conservation in transport system genes as well . This genetic conservation has implications for developing broadly effective interventions targeting membrane transport proteins.

What experimental models are available for studying S. paratyphi A proteins like phnV?

The assessment of S. paratyphi A protein function is complicated by the lack of suitable small animal models and the human-restricted nature of the infection . Researchers have two primary options:

  • Human challenge models: The University of Oxford has developed a controlled human infection model using S. paratyphi A strain NVGH308, which allows for the study of host-pathogen interactions under carefully regulated conditions . This model provides valuable opportunities to investigate protein expression patterns during actual human infection.

  • Mouse immunization studies: For preliminary functional analysis, mouse immunization models have been successfully employed, as demonstrated in studies of SpaO and H1a proteins . While mice don't develop typical enteric fever, protection rates from 41.7-66.7% with single recombinant proteins and 75.0-91.7% with co-immunization have been observed, providing a platform for comparative protein function studies .

What characterization techniques should be employed when studying novel S. paratyphi A transport proteins?

When characterizing transport proteins such as phnV, a comprehensive approach includes:

  • Genetic analysis: PCR and sequencing to determine distribution across clinical isolates (as done with SpaO and H1a, found in 97.5% and 100% of isolates, respectively)

  • Expression analysis: ELISA to assess protein expression frequency in clinical isolates (SpaO and H1a showed 98.0% and 100% expression frequencies)

  • Immunological characterization: Western blot and slide agglutination tests to confirm immunogenicity of recombinant proteins

  • Structural studies: X-ray crystallography or cryo-EM for transport proteins to determine membrane topology and substrate binding sites

How should I design experiments to express and purify recombinant phnV protein?

Based on successful approaches with other S. paratyphi A recombinant proteins:

  • Vector selection: Choose prokaryotic expression systems that have proven successful with membrane proteins. The expression of recombinant SpaO and H1a proteins demonstrates the feasibility of expressing S. paratyphi A proteins in prokaryotic systems .

  • Purification strategy: For membrane proteins like phnV, consider:

    • Detergent screening to identify optimal solubilization conditions

    • Affinity chromatography with His-tags or other fusion partners

    • Size exclusion chromatography for final purification

  • Quality control: Confirm proper folding through circular dichroism and functional assays specific to transport activity

  • Expression verification: Employ Western blot analysis similar to that used for SpaO and H1a proteins to verify expression

What considerations are important when designing a human challenge model to study S. paratyphi A proteins?

Human challenge models for S. paratyphi A require careful design considerations:

  • Strain selection: Use fully characterized, non-genetically modified strains with known antimicrobial susceptibility, such as the NVGH308 strain isolated from a patient with acute paratyphoid fever .

  • Dose determination: Implement an a priori decision-making algorithm for dose escalation/de-escalation to achieve target attack rates (60-75% for the Oxford model) while minimizing unnecessary exposure .

  • Ethical considerations: Obtain rigorous ethical approval and implement strict eligibility criteria to minimize risk to participants and their contacts .

  • Endpoint definition: Clearly define infection endpoints, such as:

    • Microbiological: One or more positive blood cultures

    • Clinical: Oral temperature exceeding 38°C sustained for at least 12 hours

  • Safety protocols: Establish protocols for prompt antibiotic treatment upon diagnosis or after the follow-up period (14 days in the Oxford model) .

Challenge Model ParameterOxford S. paratyphi A Model Specifications
Challenge strainNVGH308
Initial dose1-5×10³ CFU
Target attack rate60-75%
Group size5-10 participants per dose group
Infection definitionPositive blood culture and/or sustained fever (>38°C for ≥12h)
Treatment2-week course of oral antibiotics upon diagnosis or after 14 days
Total sample size20-80 participants

Table 1: Key parameters for human challenge model design based on the Oxford S. paratyphi A study protocol

What methods are effective for analyzing protein-protein interactions involving phnV?

To investigate interactions between phnV and other components of the phosphonate transport system or host factors:

  • Bacterial two-hybrid systems: Particularly useful for membrane proteins that may not fold properly in yeast-based systems

  • Co-immunoprecipitation with crosslinking: To capture transient interactions in the membrane environment

  • Surface plasmon resonance: For quantitative binding kinetics analysis of purified components

  • Proximity labeling techniques: Such as BioID or APEX to identify proteins in close proximity to phnV in living cells

  • Mass spectrometry-based interactomics: To identify the complete interactome of phnV under various conditions

How can genetic conservation analysis inform phnV functional studies across S. paratyphi A isolates?

The high genetic conservation observed in S. paratyphi A isolates (99.31-99.88% sequence similarity for studied genes) suggests potential evolutionary pressure to maintain certain functional elements . For phnV research:

  • Comparative genomics approach: Analyze phnV sequences across geographical isolates to identify conserved domains versus variable regions that might indicate substrate specificity differences

  • Structure-function correlation: Map conserved residues onto predicted structural models to identify functionally critical regions

  • Evolutionary context: Examine selective pressure on phnV compared to other transport systems by calculating dN/dS ratios across the gene

  • Distribution analysis: Determine if phnV is uniformly distributed across S. paratyphi A isolates (similar to spaO at 97.5% and h1a at 100%)

What immunological considerations are important when studying transport proteins like phnV in the context of vaccine development?

When considering phnV as a potential vaccine component:

  • Epitope accessibility: Unlike highly exposed proteins like flagellin H1a, membrane transporters like phnV have limited exposed epitopes, requiring careful immunogen design

  • Antigen conservation: Assess epitope conservation across clinical isolates, as high conservation (like that seen with SpaO and H1a) is favorable for broad protection

  • Immune response profiling: Evaluate both humoral and cell-mediated responses, as effective vaccines against S. paratyphi A may require both (anti-SpaO and anti-H1a IgGs were detectable in 94.8% and 98.8% of paratyphoid A patients, respectively)

  • Combination strategies: Consider how phnV might function in multi-component vaccines, as co-immunization with complementary antigens can significantly increase protection (75.0-91.7% for SpaO+H1a versus 41.7-66.7% for individual antigens)

How does phnV expression change under different environmental conditions relevant to infection?

To characterize phnV regulation during infection:

  • Transcriptional profiling: Use RNA-seq to compare phnV expression across conditions mimicking various host environments:

    • Different pH levels representing gastric and intestinal environments

    • Various phosphate/phosphonate availability conditions

    • Presence of host antimicrobial peptides

  • In vivo expression analysis: Utilize the human challenge model to collect samples for expression analysis at different stages of infection

  • Regulatory network mapping: Identify transcription factors and regulatory elements controlling phnV expression through ChIP-seq and promoter analysis

How should I approach contradictory data regarding phnV function or expression?

When faced with conflicting experimental results:

  • Context specificity analysis: Determine if contradictions arise from differences in:

    • Bacterial strains used (clinical isolates vs. laboratory strains)

    • Environmental conditions during experiments

    • Host cell types or animal models

  • Methodological comparison: Evaluate the sensitivity and specificity of different detection methods used across studies

  • Replication with controls: Design experiments that directly compare conditions generating contradictory results with appropriate positive and negative controls

  • Multi-omics integration: Combine transcriptomic, proteomic, and metabolomic data to build a comprehensive model of phnV function that may reconcile apparent contradictions

What bioinformatic approaches are most useful for predicting phnV structure and function?

For computational analysis of phnV:

  • Homology modeling: Use structural information from characterized bacterial permease proteins to predict phnV structure

  • Molecular dynamics simulations: Model phnV behavior in membrane environments with potential substrates

  • Evolutionary analysis: Compare phnV sequences across Salmonella species and related enterobacteria to identify functionally important residues through conservation patterns

  • Protein-ligand docking: Predict binding affinities for phosphonate compounds to understand substrate specificity

  • Machine learning approaches: Train models on known transporter-substrate relationships to predict phnV substrates and functional properties

What statistical considerations are important when analyzing protection data in vaccine studies targeting transport proteins?

When evaluating potential vaccines incorporating phnV or studying its role in protection:

  • Sample size determination: Calculate appropriate sample sizes to detect meaningful differences in protection, considering the 41.7-66.7% protection rates observed with single S. paratyphi A recombinant proteins

  • Attack rate analysis: In human challenge models, carefully consider the statistical implications of the target attack rate (60-75% in the Oxford model) on power calculations

  • Correlation analysis: Determine correlations between immune responses to specific epitopes and protection status

  • Multivariable modeling: Account for host factors that may influence susceptibility or response to vaccination

  • Survival analysis: Use appropriate time-to-event analyses for tracking infection development in challenge studies

Statistical ConsiderationRecommendation for S. paratyphi A Studies
Minimum sample size20 participants per dose group for 80% power to detect protection differences similar to SpaO/H1a studies
Attack rate target60-75% for optimal statistical power in challenge models
Primary outcome measureMicrobiological (positive blood culture) and clinical (sustained fever) endpoints
Key secondary analysesCorrelation between antibody titers and protection status
Covariates to considerPrevious exposure to related Salmonella species, host genetic factors

Table 2: Statistical considerations for vaccine studies based on S. paratyphi A research data

How might phnV research contribute to novel diagnostic methods for S. paratyphi A?

Transport proteins like phnV could contribute to improved diagnostics through:

  • Serological markers: Investigate whether anti-phnV antibodies could serve as diagnostic markers, similar to anti-SpaO and anti-H1a IgGs detected in 94.8% and 98.8% of paratyphoid A patients, respectively

  • Expression-based diagnostics: Develop molecular tests targeting phnV expression patterns specific to active infection

  • Functional diagnostics: Design assays based on phosphonate transport activity as metabolic indicators of viable bacteria

  • Structural epitopes: Identify phnV-specific epitopes that could be targeted in rapid diagnostic tests

What are the key challenges in translating basic phnV research into clinical applications?

Researchers face several challenges when moving from basic characterization to clinical applications:

  • Human-restricted pathogenesis: The lack of suitable animal models complicates preclinical testing, necessitating carefully designed human challenge models

  • Membrane protein complexity: Transport proteins like phnV present challenges in expression, purification, and maintaining native conformation for vaccine development

  • Functional redundancy: Multiple transport systems may have overlapping functions, potentially limiting the impact of targeting a single protein

  • Regulatory requirements: The pathway to developing clinical applications requires navigating complex regulatory frameworks for human challenge studies and vaccine development

  • Technological limitations: Current methods may be insufficient to fully characterize membrane protein dynamics in their native environment

How can systems biology approaches enhance our understanding of phnV in the context of S. paratyphi A pathogenesis?

Integrative approaches to studying phnV include:

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data from human challenge studies to place phnV in broader pathogenesis networks

  • Host-pathogen interaction mapping: Identify host factors that interact with or influence phnV function during infection

  • Mathematical modeling: Develop predictive models of phosphonate transport dynamics and their contribution to bacterial fitness in different host environments

  • Network analysis: Characterize how phnV interacts with other virulence systems, such as those involving SpaO, which acts as a major invasion factor in S. enterica

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.