Recombinant Salmonella paratyphi A Putative epimerase lsrE (lsrE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
lsrE; SPA3923; Putative epimerase LsrE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
lsrE
Target Protein Sequence
MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCP QFTVGPWAVEQLPQTFIKDVHLMVADQWTAAQACVKAGAHCITLQAEGDIHLHHTLSWLG QQTVPVIGGEMPVIRGISLCPATPLDVIIPILSDVEVIQLLAVNPGYGSKMRSSDLHERV AQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLAENTRSWRAM FKVAGDTTFLPSTA
Uniprot No.

Target Background

Database Links

KEGG: spt:SPA3923

Protein Families
Ribulose-phosphate 3-epimerase family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is lsrE and what is its role in Salmonella paratyphi A?

LsrE is a putative epimerase found in Salmonella paratyphi A, consisting of 254 amino acids. It is part of the lsr (LuxS Regulated) operon, which is involved in quorum sensing through the autoinducer-2 (AI-2) signaling molecule. While lsrE has sequence homology to epimerases, its exact functional role remains somewhat enigmatic, as deletion studies in the closely related S. typhimurium showed no detectable impact on AI-2 uptake or transcription of the lsr operon . This suggests that despite its conservation, lsrE may have redundant functionality or serve in pathways not directly related to the primary AI-2 processing mechanisms.

How does the lsrE protein from S. paratyphi A compare to homologs in other Salmonella species?

The lsrE protein maintains high sequence conservation across Salmonella species, with notable homologs in S. paratyphi B (UniProt ID: A9MZG7) and S. typhimurium. Comparing the amino acid sequences:

SpeciesUniProt IDLengthKey Differences
S. paratyphi AQ5PJE1254 aaReference sequence
S. paratyphi BA9MZG7254 aaConservative substitutions at positions 54 (E→Q) and 159 (A→E)
S. typhimurium(Not specified in data)254 aaPresent in operon but with minimal functional impact when deleted

The nearly identical sequence length and high homology suggest evolutionary conservation of lsrE across Salmonella species, despite uncertainty about its precise function .

What are the recommended methods for recombinant expression of lsrE from S. paratyphi A?

For optimal recombinant expression of lsrE from S. paratyphi A, the following methodology is recommended:

  • Expression System: E. coli is the preferred heterologous host for lsrE expression

  • Vector Design:

    • Include N-terminal His-tag for purification

    • Utilize a full-length construct (amino acids 1-254)

    • Include appropriate promoter (T7 or similar inducible system)

  • Culture Conditions:

    • Induce at OD600 of 0.6-0.8

    • Express at 18-25°C to enhance solubility

    • Continue expression for 4-16 hours depending on temperature

  • Purification Strategy:

    • Immobilized metal affinity chromatography (IMAC) utilizing the His-tag

    • Secondary purification by size exclusion chromatography

    • Buffer optimization to maintain stability (Tris/PBS-based buffer, pH 8.0)

This protocol has been demonstrated to yield protein with >90% purity as determined by SDS-PAGE analysis .

What are the optimal storage conditions for maintaining stability of purified recombinant lsrE?

To maintain optimal stability of purified recombinant lsrE:

  • Short-term Storage:

    • Store working aliquots at 4°C for up to one week

    • Maintain in Tris/PBS-based buffer at pH 8.0

  • Long-term Storage:

    • Lyophilization is recommended for extended stability

    • For liquid storage, add 5-50% glycerol (final concentration)

    • Aliquot to minimize freeze-thaw cycles

    • Store at -20°C/-80°C

  • Reconstitution Protocol:

    • Briefly centrifuge vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 50% final concentration if storing reconstituted protein

These conditions minimize protein degradation and preserve enzymatic activity for experimental use .

How can I determine if recombinant lsrE exhibits epimerase activity in vitro?

To assess the putative epimerase activity of recombinant lsrE, implement the following experimental approach:

  • Substrate Selection:

    • Test candidate sugar substrates including ribose-5-phosphate and ribulose-5-phosphate, which are known ligands for the related LsrF protein

    • Include phosphorylated AI-2 (P-AI-2) as it represents a physiologically relevant potential substrate

  • Activity Assay Design:

    • Monitor substrate-to-product conversion using HPLC or LC-MS

    • Employ coupled enzyme assays to detect NAD(P)H consumption/production

    • Use polarimetry to detect changes in optical rotation (characteristic of epimerization)

  • Controls:

    • Include heat-inactivated enzyme as negative control

    • Use characterized epimerases (e.g., UDP-glucose 4-epimerase) as positive controls

    • Test activity of site-directed mutants at predicted catalytic residues

  • Data Analysis:

    • Calculate kinetic parameters (Km, Vmax, kcat) for any observed activity

    • Compare results to related proteins in the lsr operon (particularly LsrF)

While lsrE shows sequence homology to epimerases, functional studies should not assume epimerase activity, as genetic evidence suggests potential redundancy or alternative functions in the quorum sensing pathway .

What structural predictions can be made about lsrE based on homology to characterized proteins?

Based on homology modeling and structural analysis of related proteins:

  • Predicted Structural Features:

    • lsrE likely adopts an (α/β)8-barrel fold similar to LsrF, which has been crystallized and characterized

    • The active site is predicted to reside at the C-terminal end of the β-barrel

    • Key catalytic residues are likely conserved with other aldolases/epimerases

  • Homology Models:

    • The LsrF structure (PDB ID referenced in search result ) provides a valuable template

    • The decameric quaternary structure observed in LsrF may be relevant for lsrE function

    • Conserved residues likely include those involved in phosphate binding (Ser and Arg residues)

  • Ligand Binding:

    • The binding pocket likely accommodates phosphorylated sugars

    • Phosphate group recognition probably involves a network of hydrogen bonds

    • Based on LsrF studies, residues equivalent to Lys203 may be involved in Schiff base formation

Structural predictions should be validated experimentally through techniques such as circular dichroism, thermal shift assays, and ultimately X-ray crystallography or cryo-EM.

How can I design optimal knockout experiments to study lsrE function in S. paratyphi A?

For effective knockout studies of lsrE in S. paratyphi A:

  • Gene Targeting Strategy:

    • Use lambda Red recombineering system for precise gene replacement

    • Design knockout to maintain reading frame and avoid polar effects on downstream genes in the lsr operon

    • Consider both complete gene deletion and catalytic residue point mutations

  • Experimental Design Considerations:

    • Include complementation controls to confirm phenotype specificity

    • Create double knockouts with related genes (e.g., lsrF, lsrG) to identify functional redundancy

    • Implement statistical design of experiments (DoE) approaches to maximize information from minimal experiments

  • Phenotypic Analysis:

    • Examine quorum sensing behaviors (biofilm formation, motility)

    • Assess lsr operon transcription using reporter systems

    • Measure AI-2 internalization and processing

    • Evaluate pathogenicity in appropriate models

  • Genomic Context Awareness:

    • Be attentive to the unique genomic features of S. paratyphi A, including its chromosomal inversion between rrnH and rrnG compared to other Salmonella species

    • Consider potential effects on chromosomal architecture and gene expression

Previous studies in S. typhimurium showed no detectable phenotype when lsrE was deleted , suggesting the need for sensitive assays or combinatorial knockouts to reveal function.

How does the genomic context of lsrE in S. paratyphi A differ from other Salmonella species?

The genomic context of lsrE in S. paratyphi A has unique features:

  • Chromosomal Arrangement:

    • S. paratyphi A harbors a major genomic inversion of approximately half the genome between rrnH and rrnG

    • The lsr operon organization may be affected by this large-scale chromosomal rearrangement

  • Operon Structure Comparison:

SpeciesOperon ComponentsNotable Features
S. paratyphi AlsrA, lsrB, lsrC, lsrD, lsrF, lsrG, lsrEPresent within genomic inversion region
S. typhimuriumlsrA, lsrB, lsrC, lsrD, lsrF, lsrG, lsrEStandard genomic arrangement
E. colilsrA, lsrB, lsrC, lsrD, lsrF, lsrG (no lsrE)Lacks lsrE gene entirely
  • Evolutionary Implications:

    • The chromosomal inversion in S. paratyphi A is proposed to restore balance between oriC and replication termination, following a 100-kb insertion event

    • This genomic reorganization is present in all tested wild-type S. paratyphi A strains

    • The conservation of lsrE despite its apparent dispensability suggests potential selection pressure or alternative functions

These genomic differences should be considered when designing experiments and interpreting results across Salmonella species .

How can recombinant lsrE be utilized in vaccine development strategies?

Recombinant lsrE offers several potential applications in vaccine development:

  • Antigen Potential Assessment:

    • Evaluate lsrE as a potential vaccine antigen through immunogenicity studies

    • Test whether antibodies against lsrE provide protection in infection models

    • Consider including lsrE in multicomponent subunit vaccine formulations

  • Vector Engineering Applications:

    • Utilize recombinant S. paratyphi A strains expressing modified lsrE as live attenuated vaccine candidates

    • Consider the approach demonstrated with Vi polysaccharide, where engineering S. paratyphi A to express S. Typhi antigens created bivalent protection

    • Evaluate whether lsrE modification affects colonization, persistence, or immunogenicity

  • Strain Characterization Methods:

    • Develop lsrE-based typing methods to distinguish vaccine strains from wild-type isolates

    • Create reporter systems based on lsrE expression to monitor vaccine strain behavior in vivo

  • Experimental Design Considerations:

    • Implement robust statistical designs for animal studies to maximize information while minimizing sample sizes

    • Measure both humoral and cell-mediated immune responses to recombinant lsrE

While the functional significance of lsrE remains unclear, its conservation across Salmonella strains makes it a potential target for vaccine-related applications .

What experimental design approaches would optimize structure-function studies of lsrE?

To optimize structure-function studies of lsrE:

  • Factorial Experimental Design:

    • Implement statistical Design of Experiments (DoE) approaches to systematically explore multiple variables

    • Develop fractional factorial designs to efficiently screen conditions for crystallization or functional assays

    • Follow this template for systematic exploration:

FactorLow LevelMid LevelHigh Level
pH6.57.58.5
Temperature4°C20°C37°C
Protein concentration1 mg/mL5 mg/mL10 mg/mL
Salt concentration50 mM150 mM300 mM
  • Mutational Analysis Strategy:

    • Design a systematic mutational scan targeting:

      • Predicted catalytic residues (based on homology to LsrF)

      • Interface residues involved in oligomerization

      • Substrate binding pocket residues

    • Apply statistical analysis to distinguish significant from non-significant effects

  • Structural Biology Approach:

    • Pursue parallel crystallization and cryo-EM strategies

    • Co-crystallize with potential substrates (ribose-5-phosphate, ribulose-5-phosphate)

    • Implement in silico docking studies to generate testable hypotheses

  • Data Integration Framework:

    • Develop a systematic approach to integrate data from:

      • Structural studies (crystallography/cryo-EM)

      • Functional assays (enzymatic activity)

      • Biophysical characterization (thermal stability, binding affinities)

      • In vivo phenotypic studies

By applying these rigorous experimental design principles from DoE literature , researchers can maximize information yield while minimizing experimental resources.

What are common challenges in recombinant lsrE expression and how can they be addressed?

Researchers commonly encounter several challenges when expressing recombinant lsrE:

  • Protein Solubility Issues:

    • Challenge: lsrE may form inclusion bodies in E. coli

    • Solutions:

      • Lower induction temperature (16-18°C)

      • Co-express with chaperones (GroEL/GroES, DnaK)

      • Optimize codon usage for E. coli expression

      • Test solubility tags (MBP, SUMO, TrxA) in addition to His-tag

  • Protein Stability Problems:

    • Challenge: Purified lsrE may show limited stability during storage

    • Solutions:

      • Optimize buffer composition (add glycerol, reducing agents)

      • Implement controlled lyophilization protocols

      • Add stabilizing osmolytes (trehalose, sucrose)

      • Test multiple pH conditions around the theoretical isoelectric point

  • Activity Detection Difficulties:

    • Challenge: Detecting epimerase activity can be challenging

    • Solutions:

      • Test multiple potential substrates based on known epimerases

      • Implement sensitive detection methods (LC-MS, NMR)

      • Consider coupled enzyme assays for indirect activity measurement

      • Verify protein folding using circular dichroism before activity tests

  • Oligomerization Variability:

    • Challenge: Based on LsrF homology, lsrE may form decamers, but conditions may affect oligomerization

    • Solutions:

      • Verify oligomeric state using size exclusion chromatography

      • Confirm using orthogonal methods (analytical ultracentrifugation)

      • Optimize salt and pH conditions to maintain native oligomeric state

These troubleshooting approaches are based on general protein expression principles and specific insights from LsrF structural studies .

How can researchers resolve conflicting data between genomic predictions and experimental results for lsrE function?

When faced with discrepancies between genomic predictions and experimental results for lsrE:

  • Systematic Analysis Framework:

    • Compare computational predictions from multiple algorithms/databases

    • Evaluate confidence metrics for each prediction

    • Design experiments specifically targeting the areas of disagreement

    • Implement statistical approaches to quantify the significance of experimental findings

  • Resolution Strategies for Common Conflicts:

Type of ConflictInvestigation ApproachAnalysis Method
Predicted vs. observed enzyme activityTest broader substrate rangeEnzyme kinetics with multiple substrates
Predicted vs. observed phenotype of knockoutCreate conditional or tissue-specific knockoutsDifferential phenotyping under various conditions
Predicted vs. observed protein-protein interactionsUse multiple interaction detection methodsYeast two-hybrid, pull-down, and in vivo crosslinking
Predicted vs. observed localizationCreate GFP fusions with truncation seriesSubcellular fractionation and microscopy
  • Contextual Factors to Consider:

    • Genetic background effects (strain differences)

    • Growth/experimental conditions that may mask phenotypes

    • Genetic redundancy (paralogs providing compensation)

    • Post-translational modifications not predicted genomically

    • The known chromosomal inversion in S. paratyphi A that may affect gene expression

  • Integration with Known lsr Operon Function:

    • Consider that lsrE deletion in S. typhimurium showed no detectable impact on AI-2 uptake or lsr operon transcription

    • Evaluate whether lsrE might function in pathways separate from its genomic context

    • Design experiments to detect subtle phenotypes or condition-specific functions

Through this systematic approach, researchers can distinguish between true biological findings and technical artifacts or limitations in predictive algorithms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.