Recombinant Salmonella paratyphi A Putative protein-disulfide oxidoreductase (SPA3062)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Pathogenesis

SPA3062 is hypothesized to act as a protein-disulfide oxidoreductase, analogous to DsbA in Salmonella Typhimurium, which facilitates oxidative folding of virulence factors. Key findings include:

  • Type III Secretion System (TTSS) Dependency: DsbA homologs are essential for the function of TTSS apparatus proteins like SpiA (SsaC), which require disulfide bonds for membrane localization and activity .

  • Virulence Attenuation: dsbA mutants in Salmonella exhibit reduced TTSS-mediated invasion and systemic infection in murine models .

  • Substrate Specificity: Targets include outer membrane proteins and secretion system components, enabling bacterial evasion of host immune responses .

Applications in Vaccine Development

SPA3062-associated pathways inform vaccine strategies against S. Paratyphi A:

  • O-Antigen Glycoconjugate Vaccines: Conjugates of S. Paratyphi A O-antigen (e.g., O:2-CRM197_{197}) induce bactericidal antibodies effective against diverse clinical isolates, independent of O-acetylation or glucosylation levels .

  • Outer Membrane Protein Targets: Immunization with recombinant outer membrane proteins (e.g., LamB, PagC) elicits protective immunity in mice, highlighting the potential for multi-component vaccines .

Research Limitations and Future Directions

  • Unresolved Questions: The exact substrate profile and regulatory interactions of SPA3062 remain uncharacterized.

  • Therapeutic Potential: Targeting SPA3062 with small-molecule inhibitors could disrupt Salmonella virulence, but in vivo efficacy studies are needed .

  • Comparative Studies: Structural alignment with DsbA homologs could clarify functional divergence across Salmonella serovars .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments default to standard blue ice packs. If dry ice is required, please communicate this in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
dsbI; SPA3062; Protein-disulfide oxidoreductase DsbI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
dsbI
Target Protein Sequence
MDFIKGLWRDLRARPVDTLVRWQEQRFLWLLMAIAMGGLIILAHSFFQIYLYMAPCEQCV YIRYAMFVMVIGGVIAAINPKNIVLKLIGCIAAFYGSIMGIKFSIKLNGIHHAVHNADPD SLFGVQGCSTDPTFPFNLPLAEWAPEWFKPTGDCGYDAPIVPDGVTLSSVQQWFVDLYQQ SEGWYLLPPWHFMNMAQACMLAFGLCLILLLVMSGAWALKLARGK
Uniprot No.

Target Background

Function
This protein is essential for disulfide bond formation in certain proteins. It functions as part of a redox system, comprised of DsbI and DsbL, which mediates the formation of an essential disulfide bond in AssT.
Database Links

KEGG: spt:SPA3062

Protein Families
DsbB family, DsbI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is SPA3062 and what is its functional role in Salmonella paratyphi A?

SPA3062 is a putative protein-disulfide oxidoreductase from Salmonella paratyphi A (strain ATCC 9150/SARB42) with UniProt identifier Q5PMU6. Based on comparative analysis with similar proteins in other Salmonella species, SPA3062 likely functions in the bacterial periplasm to catalyze the formation of disulfide bonds in substrate proteins .

The functional role of SPA3062 can be inferred from studies of similar disulfide oxidoreductases such as SrgA in Salmonella enterica serovar Typhimurium. These enzymes are critical for proper protein folding by introducing disulfide bonds into target proteins, which is essential for maintaining protein stability and function. In S. Typhimurium, the homologous disulfide oxidoreductase SrgA is specifically involved in the oxidation of structural proteins like PefA, a major fimbrial subunit protein, which requires proper disulfide bond formation for stability and subsequent fimbrial assembly .

How does SPA3062 compare structurally and functionally to other bacterial disulfide oxidoreductases?

SPA3062 shares sequence similarities with other bacterial disulfide oxidoreductases, particularly those in the DsbA family. Based on sequence analysis of similar proteins, SPA3062 likely contains a thioredoxin-like fold with a catalytic CXXC motif that is characteristic of disulfide oxidoreductases .

Functionally, we can draw comparisons with the well-characterized SrgA from S. Typhimurium. SrgA demonstrates substrate specificity that differs from the more general DsbA oxidoreductase. While SrgA can complement DsbA function when expressed in multiple copies, it shows lower efficiency than DsbA in oxidizing some substrates (like alkaline phosphatase) but higher specificity for certain targets like the fimbrial protein PefA .

The following table compares key features of SPA3062 with related bacterial disulfide oxidoreductases:

CharacteristicSPA3062 (S. paratyphi A)SrgA (S. Typhimurium)DsbA (E. coli)
Cellular localizationLikely periplasmicPeriplasmicPeriplasmic
Substrate rangeUnknown (likely specific)More substrate-specificBroad substrate range
Dependence on DsbBLikely dependentDependentDependent
Key substratesUnknownPefA (fimbrial protein)Multiple proteins
Complementation of DsbAUnknownPartial (in multiple copies)N/A

What expression systems and purification methods are recommended for obtaining active recombinant SPA3062?

For expression and purification of active recombinant SPA3062, researchers should consider the following methodology based on common approaches for similar disulfide oxidoreductases:

  • Expression system selection: E. coli-based expression systems are commonly used, with preference for strains optimized for disulfide bond formation (such as Origami™ or SHuffle®) to enhance proper protein folding.

  • Expression vector: Vectors containing tags that aid in purification (His-tag, GST-tag) while minimizing interference with protein function are recommended .

  • Growth conditions: Expression at lower temperatures (16-25°C) after induction often improves proper folding of disulfide-containing proteins.

  • Purification approach: A multi-step purification process typically yields the best results:

    • Initial capture using affinity chromatography (Ni-NTA for His-tagged constructs)

    • Secondary purification using ion exchange chromatography

    • Final polishing step with size exclusion chromatography

  • Buffer composition: The final storage buffer should be optimized for stability, such as Tris-based buffer with 50% glycerol as used for commercial preparations .

What experimental approaches are most effective for investigating SPA3062 substrate specificity?

Investigating the substrate specificity of SPA3062 requires methodologies that can identify potential protein substrates and characterize the oxidoreductase-substrate interactions. Based on approaches used for similar proteins, the following experimental strategies are recommended:

  • Comparative activity assays: Measure the oxidative folding activity of SPA3062 against standard substrates (e.g., reduced RNase A, alkaline phosphatase) compared to other oxidoreductases like DsbA. Quantitative analysis of disulfide oxidoreductase activity, as performed with SrgA, can reveal substrate preferences .

  • Complementation studies: Express SPA3062 in strains lacking other disulfide oxidoreductases (e.g., ΔdsbA E. coli strains) and assess its ability to restore disulfide bond formation in various substrate proteins. This approach helped identify SrgA's preference for PefA in S. Typhimurium studies .

  • Pull-down assays with substrate trapping: Create active site mutants of SPA3062 that form stable mixed disulfides with substrates, allowing for affinity purification of interacting proteins followed by mass spectrometry identification.

  • In vitro oxidative folding assays: Monitor the rate of disulfide bond formation in potential substrate proteins using biochemical techniques such as:

    • Intrinsic tryptophan fluorescence changes during folding

    • Differential migration of oxidized versus reduced proteins on non-reducing SDS-PAGE

    • Ellman's reagent to quantify free thiols remaining after oxidation

These approaches can be combined with structural studies to understand the molecular basis of substrate recognition and specificity.

How can researchers effectively measure the enzymatic activity of SPA3062?

Measuring the enzymatic activity of protein-disulfide oxidoreductases like SPA3062 requires specialized assays that can detect disulfide bond formation or isomerization. The following methodological approaches are recommended:

  • Insulin reduction assay: A classic assay where the reduction of insulin by DTT is accelerated by disulfide oxidoreductases, leading to insulin precipitation that can be monitored spectrophotometrically.

  • Fluorescent peptide-based assays: Utilize peptides containing two cysteines and a fluorophore-quencher pair, where disulfide formation changes the fluorescence signal.

  • Physiological substrate oxidation analysis: Monitor the oxidation state of a known or suspected substrate protein over time. For example, with SrgA, researchers monitored the oxidation state of PefA using SDS-PAGE mobility shift under reducing versus non-reducing conditions .

  • Coupled enzymatic assays: Measure the rate of electron transfer to partner proteins (likely DsbB for SPA3062, based on SrgA's dependence on DsbB) using purified components and a suitable electron acceptor like ubiquinone .

The following table summarizes key parameters to consider when establishing activity assays for SPA3062:

Assay ParameterConsiderationsTypical Range
pHOxidoreductases have pH optima; test rangepH 5.5-8.0
TemperatureActivity may vary significantly25-37°C
Redox bufferGlutathione ratios affect activityGSH:GSSG 1:1 to 100:1
Substrate concentrationDetermine Km values1-100 μM
Enzyme concentrationEnsure linear response range10-500 nM
Divalent cationsMay affect activity0-10 mM Mg²⁺/Ca²⁺

What role might SPA3062 play in Salmonella paratyphi A pathogenesis and virulence?

The potential role of SPA3062 in S. paratyphi A pathogenesis can be inferred from studies of similar oxidoreductases in related Salmonella species. Based on the function of SrgA in S. Typhimurium, SPA3062 likely contributes to virulence through the following mechanisms:

  • Virulence factor maturation: SPA3062 may be essential for the proper folding and stability of secreted virulence factors that contain disulfide bonds. In S. Typhimurium, SrgA is required for the stability of PefA, a major structural component of plasmid-encoded fimbriae .

  • Adhesion and colonization: By ensuring proper disulfide bond formation in surface proteins like fimbriae, SPA3062 could be critical for bacterial adherence to host cells and colonization of tissues.

  • Stress resistance: Proper protein folding in the periplasm contributes to bacterial survival under stress conditions encountered during infection, including oxidative stress and pH changes.

  • Immune evasion: Correctly folded surface proteins may contribute to immune evasion strategies or resistance to host antimicrobial peptides.

To investigate these potential roles, researchers should consider:

  • Creating SPA3062 deletion mutants and testing their virulence in appropriate infection models

  • Identifying specific substrates of SPA3062 and assessing their contributions to virulence

  • Evaluating the effect of SPA3062 deletion on bacterial survival under various stress conditions

  • Comparing the virulence protein profiles of wild-type and SPA3062-deficient strains

What methodologies are appropriate for studying SPA3062 interactions with potential partner proteins?

Studying protein-protein interactions involving SPA3062 requires approaches that can detect transient interactions that occur during the catalytic cycle of disulfide oxidoreductases. Based on studies of similar proteins, the following methodologies are recommended:

  • Active site mutant trap strategy: Create SPA3062 variants with mutations in the resolving cysteine of the CXXC motif to trap mixed disulfide intermediates with substrate proteins, allowing for their identification.

  • Bacterial two-hybrid systems: Modified for periplasmic proteins to screen for potential interaction partners in vivo.

  • Co-immunoprecipitation with crosslinking: Use chemical crosslinkers that can stabilize transient interactions before cell lysis and immunoprecipitation.

  • Surface plasmon resonance (SPR): Measure binding kinetics and affinities between purified SPA3062 and candidate partner proteins under various redox conditions.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identify regions of conformational change upon binding of SPA3062 to partners like DsbB or substrate proteins.

When designing interaction studies, researchers should consider:

  • SPA3062 likely interacts with DsbB for reoxidation, based on the dependence of SrgA activity on DsbB in S. Typhimurium

  • The interaction between oxidoreductases and their substrates is typically transient, requiring specialized methods for detection

  • The redox state of the active site cysteines will significantly affect interaction profiles

How should researchers design experiments to investigate SPA3062 function in vivo?

When investigating SPA3062 function in vivo, researchers should implement experimental designs that account for the complexity of disulfide bond formation pathways and potential redundancy among oxidoreductases. The following approaches are recommended:

  • Gene deletion and complementation: Create SPA3062 knockout strains and complement with wild-type or mutant versions to establish functional relationships. This approach should follow the single-case design (SCD) principles described in the literature, with proper controls and replication .

  • Phenotypic analysis: Assess the impact of SPA3062 deletion on:

    • Growth under various conditions (oxidative stress, different pH values)

    • Expression and stability of periplasmic and membrane proteins

    • Fimbrial assembly and other virulence-associated structures

    • Virulence in appropriate infection models

  • Conditional expression systems: Use inducible promoters to control SPA3062 expression levels and timing to study dose-dependent effects and temporal requirements.

  • Reporter fusion proteins: Develop reporter systems to monitor disulfide bond formation in vivo, similar to the MalF-LacZ102 fusion used in studies of DsbA and SrgA .

When designing these experiments, researchers should follow established principles for enhancing internal validity as described for single-case designs, including :

  • Controlling for ambiguous temporal precedence by clearly establishing cause-effect relationships

  • Including appropriate controls and replications (minimum of three demonstrations of effect)

  • Implementing phase repetition to strengthen causal inferences

What are the challenges in purifying active recombinant SPA3062 and how can they be addressed?

Purifying active recombinant disulfide oxidoreductases like SPA3062 presents several challenges related to maintaining proper redox state and structural integrity. The following table outlines common challenges and recommended solutions:

ChallengePotential Solutions
Maintaining active site redox state- Purify under mildly oxidizing conditions
- Add low concentrations of oxidized glutathione to buffers
- Minimize exposure to reducing agents
Preventing aggregation- Include stabilizing agents (glycerol, low concentrations of detergents)
- Optimize salt concentration in buffers
- Perform purification at lower temperatures
Ensuring proper folding- Express in strains engineered for disulfide bond formation
- Consider periplasmic expression strategies
- Include folding chaperones during refolding if using inclusion bodies
Removing contaminating proteins- Implement multi-step purification strategy
- Consider on-column refolding techniques
- Use size exclusion as final polishing step
Preventing proteolytic degradation- Include protease inhibitors in lysis buffers
- Work quickly and keep samples cold
- Consider adding stabilizing agents like glycerol (50%) as used for commercial preparations

Researchers should also consider testing the activity of the purified protein against standard substrates to confirm that the purification process has maintained its catalytic properties.

How can researchers analyze the redox properties of SPA3062 and their impact on its function?

The redox properties of SPA3062, including its reduction potential and active site pKa values, are critical determinants of its function as a disulfide oxidoreductase. The following methodological approaches are recommended for analyzing these properties:

  • Determination of reduction potential:

    • Direct electrochemical methods using protein film voltammetry

    • Equilibrium methods using defined ratios of oxidized and reduced glutathione

    • Kinetic approaches comparing reaction rates with substrates of known reduction potentials

  • Measurement of active site pKa values:

    • pH-dependent changes in absorption spectra

    • NMR titration of active site residues

    • pH-dependent enzyme kinetics

  • Analysis of redox state-dependent structural changes:

    • Circular dichroism spectroscopy under varying redox conditions

    • Intrinsic fluorescence spectroscopy (if tryptophan residues are appropriately positioned)

    • Hydrogen-deuterium exchange mass spectrometry

  • Functional correlation with redox properties:

    • Site-directed mutagenesis of active site residues and flanking sequences

    • Activity assays under controlled redox conditions

    • Substrate oxidation efficiency as a function of reduction potential difference

Drawing from studies of similar proteins like SrgA, researchers should consider how variations in redox properties might contribute to substrate specificity. For instance, SrgA's substrate specificity for PefA compared to DsbA's broader substrate range may reflect differences in their redox properties .

How should researchers analyze and interpret data from SPA3062 functional studies?

When analyzing data from SPA3062 functional studies, researchers should implement rigorous analytical approaches that account for the complexity of enzyme kinetics and potential variability in experimental systems. The following methodological guidelines are recommended:

  • Enzyme kinetic data analysis:

    • Fit data to appropriate models (Michaelis-Menten, competitive inhibition, etc.)

    • Determine key parameters (kcat, Km) and compare with related enzymes

    • Account for potential biphasic kinetics common in disulfide oxidoreductases

  • Statistical considerations for in vivo studies:

    • Follow established protocols for single-case design studies, including demonstration of experimental control through replication

    • Implement randomization where possible to strengthen causal inferences

    • Address potential threats to internal validity as outlined in the literature

  • Data visualization approaches:

    • Use tables to organize detailed numerical data rather than including it in text

    • Implement appropriate graphical representations for different data types

    • Present data in ways that highlight patterns and trends, particularly for comparing SPA3062 with other oxidoreductases

  • Comparative analysis framework:

    • When comparing SPA3062 to other oxidoreductases (like SrgA or DsbA), ensure consistent experimental conditions and proper controls

    • Consider context-dependent effects, such as how expression levels might influence apparent activity

The table below summarizes key parameters that should be reported in SPA3062 functional studies:

Parameter CategorySpecific MeasurementsReporting Format
Kinetic parameterskcat, Km, catalytic efficiencyMean ± SD from ≥3 independent experiments
Redox propertiesReduction potential, pKa valuesStandard reduction potential (mV vs. SHE)
Substrate specificityRelative activity across substratesNormalized data (%) with reference standard
In vivo functionComplementation efficiencyQuantitative measure with statistical analysis
Protein-protein interactionsBinding constants, association/dissociation ratesKD values with confidence intervals

What methods can researchers use to resolve contradictory findings in SPA3062 research?

When faced with contradictory findings in SPA3062 research, researchers should implement systematic approaches to identify sources of discrepancy and resolve conflicting data. The following methodological framework is recommended:

  • Systematic comparison of experimental conditions:

    • Analyze differences in protein preparation (expression system, purification method)

    • Compare buffer compositions, pH, temperature, and other environmental factors

    • Assess variations in substrate preparation and handling

  • Reproducibility assessment:

    • Implement standardized protocols across laboratories

    • Conduct blind replication studies with shared reagents

    • Consider collaborative validation studies

  • Methodological triangulation:

    • Approach the same question using multiple independent methods

    • Compare in vitro, in vivo, and in silico approaches

    • Apply both structural and functional analytical techniques

  • Reconciliation strategies:

    • Develop integrated models that can explain apparently contradictory results

    • Identify conditional factors that may explain context-dependent differences

    • Consider how expression levels influence function, as seen with SrgA where overexpression led to accumulation of reduced PefA

  • Enhanced experimental design:

    • Implement single-case design principles with sufficient replications and controls

    • Use randomization where possible to strengthen internal validity

    • Design experiments specifically to test competing hypotheses

When presenting reconciled findings, researchers should use tables to clearly organize the contradictory data and the factors that may explain the discrepancies, following best practices for table construction in scientific literature .

What emerging technologies could advance our understanding of SPA3062 function and regulation?

Several cutting-edge technologies offer promising approaches for deeper investigation of SPA3062 function and regulation:

  • Cryo-electron microscopy:

    • Structural determination of SPA3062 in complex with partner proteins

    • Visualization of conformational changes during the catalytic cycle

    • Analysis of higher-order protein complexes involving SPA3062

  • Time-resolved X-ray crystallography and spectroscopy:

    • Capture transient intermediates during disulfide exchange reactions

    • Monitor structural changes during catalysis on millisecond to second timescales

    • Correlate structural dynamics with catalytic function

  • Advanced mass spectrometry approaches:

    • Crosslinking mass spectrometry to map protein interaction networks

    • Native mass spectrometry to study protein complexes

    • Redox proteomics to identify substrates and monitor their oxidation states

  • Genome-wide approaches:

    • CRISPR-Cas9 screens to identify genetic interactions with SPA3062

    • RNA-seq analysis of transcriptional changes in SPA3062 mutants

    • Proteomics profiling to identify proteins affected by SPA3062 deletion

  • Single-molecule techniques:

    • Förster resonance energy transfer (FRET) to monitor conformational changes

    • Optical tweezers to study mechanical aspects of protein folding

    • Single-molecule tracking in live bacteria to visualize localization and dynamics

How might the study of SPA3062 contribute to broader understanding of bacterial pathogenesis mechanisms?

Research on SPA3062 has potential to advance our understanding of bacterial pathogenesis in several important ways:

  • Virulence factor biogenesis: Understanding how SPA3062 contributes to proper folding of virulence factors can reveal critical pathways in pathogenesis, similar to how SrgA was found essential for plasmid-encoded fimbriae assembly in S. Typhimurium .

  • Host-pathogen interaction mechanisms: By identifying SPA3062 substrates involved in host cell adhesion, invasion, or immune evasion, researchers can uncover novel aspects of Salmonella paratyphi A pathogenesis.

  • Bacterial adaptation to host environments: Study of SPA3062 regulation under conditions mimicking the host environment could reveal adaptation mechanisms employed by S. paratyphi A during infection.

  • Evolutionary perspectives: Comparative analysis of SPA3062 with homologs in other pathogens can illuminate how disulfide oxidoreductases have evolved to support pathogen-specific virulence mechanisms.

  • Potential therapeutic targets: Understanding the role of SPA3062 in pathogenesis could identify new targets for antimicrobial development, particularly if SPA3062 is found to be essential for virulence but not for basic bacterial growth.

When designing research to address these broader questions, investigators should implement rigorous experimental design principles, including appropriate controls, replications, and statistical approaches as outlined for single-case design studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.