Recombinant Salmonella paratyphi A Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Functional Roles

Key Biological Activities

  • Substrate Specificity: Cleaves orphan TMDs of respiratory complex subunits (e.g., HybA, FdoH) when unpaired .

  • Quality Control: Initiates degradation of uncomplexed proteins to prevent membrane aggregation .

  • Regulatory Role: Indirectly influences glycerol metabolism via polar effects on glpR in E. coli .

Enzymatic Activity

ParameterDetailSource
Cleavage SiteHydrophilic regions of TMDs (e.g., between Ser-Asp) In vitro assays
Catalytic ResiduesSer-201, His-265 (critical for proteolysis) Mutational studies
InhibitorsCu²⁺ destabilizes Fe-S clusters in substrates, enhancing degradation Stress assays

Recombinant Production

Expression & Purification

  • Host: E. coli systems optimize yield (~85% purity via SDS-PAGE) .

  • Form: Lyophilized powder stabilized in phosphate-buffered saline .

  • Applications: Vaccine development, enzymatic assays, structural biology .

Stability

  • Survives >3 months at -80°C .

  • Activity retained after repeated freeze-thaw cycles .

Research Findings

Key Studies

  1. Membrane Protein Quality Control (2020):

    • GlpG homologs in Shigella selectively degrade orphan subunits of hydrogenase-2 and formate dehydrogenase .

    • Cleavage licenses subsequent proteolytic degradation under anaerobic conditions .

  2. Gut Colonization (2017):

    • E. coli GlpG supports persistence in murine gut by regulating fatty acid β-oxidation via glpR .

    • ΔglpG mutants show 120-fold reduction in gut colonization .

  3. Enzymatic Mechanism (2005):

    • E. coli GlpG cleaves model substrates at hydrophilic juxtamembrane regions .

    • Catalytic serine mutation (S201A) abolishes activity .

Comparative Analysis

GlpG Across Salmonella Serovars

SerovarUniProt IDKey Feature
S. Paratyphi ANot resolvedUsed in recombinant vaccine studies
S. SchwarzengrundB4TY77276aa, His-tagged
S. HeidelbergB4TKV0276aa, 85% purity
S. AgonaB5F8P0Six TMDs, EC 3.4.21.105

Applications and Limitations

Therapeutic Potential

  • Vaccine candidate: GlpG surface exposure makes it a target for anti-Salmonella vaccines .

  • Antibiotic adjuvants: Inhibiting GlpG could disrupt bacterial membrane homeostasis .

Challenges

  • Substrate redundancy: Rhomboids GlpG and Rhom7 share overlapping roles .

  • Conditional activity: Cleavage occurs only when substrates are orphaned .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
glpG; SSPA3157; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRVELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVVVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAS WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT
Uniprot No.

Target Background

Function

Rhomboid-type serine protease that catalyzes intramembrane proteolysis.

Database Links

KEGG: sek:SSPA3157

Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Salmonella paratyphi A Rhomboid protease glpG?

Recombinant Salmonella paratyphi A Rhomboid protease glpG is an intramembrane serine protease (EC 3.4.21.105) derived from Salmonella paratyphi A strain ATCC 9150/SARB42. The protein consists of 276 amino acids with UniProt accession Q5PLZ8 and plays a critical role in bacterial membrane protein processing. This recombinant version is produced through genetic engineering techniques that allow for protein expression in controlled laboratory conditions, enabling detailed structural and functional studies that would otherwise be difficult with native protein isolation .

The protein contains multiple transmembrane domains that form a characteristic fold within the membrane bilayer, which is essential for its proteolytic function. Researchers typically use recombinant versions with specific tags for purification and detection purposes, though the exact tag configuration may vary based on production requirements and experimental needs .

What is the amino acid sequence of the glpG protein, and what structural features are notable?

The amino acid sequence of Salmonella paratyphi A Rhomboid protease glpG is:
mLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRVELARFIENPGDPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVmLACVVVYIAMSLIGDQTVMVWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVASWFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT

Key structural features include:

  • Multiple transmembrane domains creating a hydrophobic core within the lipid bilayer

  • A catalytic serine residue essential for proteolytic activity

  • Conserved water-retention sites that facilitate intramembrane proteolysis

  • Loop regions that contribute to substrate recognition and specificity

The protein's structure allows it to cleave transmembrane substrates within the lipid bilayer, a unique enzymatic environment that presents specific challenges for functional studies and inhibitor design .

How should Recombinant Salmonella paratyphi A Rhomboid protease glpG be stored and handled in laboratory settings?

For optimal preservation of activity, Recombinant Salmonella paratyphi A Rhomboid protease glpG should be stored in Tris-based buffer with 50% glycerol at -20°C for routine storage or -80°C for extended preservation. The high glycerol content is critical for maintaining protein stability and preventing denaturation during freeze-thaw cycles .

Best practices for handling include:

  • Avoiding repeated freeze-thaw cycles which significantly reduce enzymatic activity

  • Working with aliquots at 4°C for up to one week to minimize degradation

  • Using fresh aliquots for critical experiments requiring maximum enzyme activity

  • Performing all manipulations on ice when preparing reaction mixtures

  • Verifying protein integrity via SDS-PAGE before conducting sensitive experiments

When incorporating the protein into functional assays, researchers should consider the detergent environment carefully, as rhomboid proteases require specific membrane-mimetic conditions to maintain their native conformation and activity .

What considerations are important when designing experiments with Recombinant Salmonella paratyphi A Rhomboid protease glpG?

When designing experiments with Recombinant Salmonella paratyphi A Rhomboid protease glpG, researchers should implement optimal experimental design principles to maximize statistical power while minimizing resource utilization. For studies with large datasets, researchers should consider retrospective designed sampling approaches that can dramatically improve analysis efficiency compared to analyzing all available data or using random sampling methods .

Key experimental design considerations include:

  • Statistical power calculations to determine appropriate sample sizes

  • Selection of appropriate controls (both positive and negative)

  • Accounting for the membrane-bound nature of the enzyme in activity assays

  • Designing experiments that distinguish between rhomboid-specific effects and non-specific membrane disruption

  • Incorporating data reduction techniques when dealing with high-throughput screening results

Researchers have found that designed experimental approaches can achieve equivalent statistical power with approximately half the sample size compared to random sampling methods in similar biological systems. For example, in regression studies with correlated predictors (common in biological systems), designed approaches yielded information matrices with determinants 1.5-2 times higher than random sampling .

How can principles of optimal experimental design be applied to studies involving Recombinant Salmonella paratyphi A Rhomboid protease glpG?

Optimal experimental design principles can significantly enhance studies involving Recombinant Salmonella paratyphi A Rhomboid protease glpG by creating more efficient and statistically robust experiments. When dealing with large datasets generated from high-throughput screening or omics approaches, implementing these principles can address challenges related to data size, heterogeneity, and quality .

A systematic approach involves:

  • Clearly defining the research question and corresponding utility function (e.g., parameter estimation precision, prediction accuracy)

  • Implementing sequential design approaches where initial experiments inform subsequent ones

  • Utilizing covariance information to select optimal experimental conditions

  • Employing computational optimization algorithms to determine ideal sampling points

Table 1: Comparison of Parameter Estimation Approaches in Complex Biological Systems

ApproachSample Size RequiredRelative PrecisionComputational Time
Full Dataset AnalysisN (large)1.0 (reference)High
Random Subsetting~0.5N0.7-0.8Low
Optimal Design Subsetting~0.25N0.9-0.95Medium

Studies implementing these principles have demonstrated that optimally designed experiments can achieve comparable precision to full dataset analysis while analyzing only 25-30% of the data points, representing significant savings in computational resources and analysis time .

What methodologies are most effective for measuring the enzymatic activity of Recombinant Salmonella paratyphi A Rhomboid protease glpG?

Measuring the enzymatic activity of Recombinant Salmonella paratyphi A Rhomboid protease glpG requires specialized approaches due to its intramembrane nature. Several complementary methodologies provide robust assessment of activity:

  • Fluorogenic peptide substrates: Using peptides with fluorophore-quencher pairs that span the predicted cleavage site allows for real-time monitoring of proteolytic activity through increased fluorescence upon cleavage.

  • Reconstituted proteoliposome systems: Incorporating the purified rhomboid protease into artificial liposomes with defined lipid composition provides a near-native environment for activity studies.

  • Cell-based cleavage assays: Expressing both the rhomboid protease and tagged substrate proteins in heterologous systems allows for monitoring of substrate processing through western blotting or reporter systems.

  • ELISA-based approaches: These can quantitatively measure specific cleavage products when appropriate antibodies are available .

For kinetic studies, researchers should consider:

  • Buffer composition (pH, ionic strength)

  • Detergent type and concentration

  • Substrate concentration range

  • Temperature and time course parameters

  • Presence of potential cofactors or inhibitors

Validation studies comparing these methods show that reconstituted systems typically provide the most physiologically relevant results but are technically challenging, while fluorogenic assays offer greater throughput at the cost of some biological fidelity.

What challenges exist in developing human models for studying Salmonella Paratyphi A and its proteins like rhomboid protease glpG?

Developing human models for studying Salmonella Paratyphi A and its proteins presents several significant challenges that researchers must carefully address:

  • Ethical considerations: Human challenge studies must balance scientific value against potential risks to volunteers, requiring stringent participant selection criteria and safety protocols.

  • Dose standardization: Establishing the optimal infectious dose that produces reliable infection while minimizing risk requires careful titration studies.

  • Endpoint definition: Determining appropriate clinical and microbiological endpoints that accurately reflect disease processes while ensuring participant safety.

  • Protein function validation: Connecting in vitro observations about proteins like rhomboid protease glpG to their actual function during human infection.

Current protocols address these challenges through:

  • Utilizing a priori decision-making algorithms to adjust challenge doses

  • Defining infection through both microbiological (positive blood cultures) and clinical (sustained fever >38°C for 12+ hours) endpoints

  • Implementing prompt antibiotic intervention upon diagnosis or after 14 days of follow-up

  • Utilizing the specific NVGH308 strain with well-characterized virulence properties

These human challenge models represent a significant advance in understanding Salmonella Paratyphi A pathogenesis, providing opportunities to evaluate the role of specific proteins like rhomboid protease glpG in actual human infection rather than artificial systems .

How might Recombinant Salmonella paratyphi A Rhomboid protease glpG be targeted for therapeutic development?

Recombinant Salmonella paratyphi A Rhomboid protease glpG presents a promising target for therapeutic development due to its essential functions and structural uniqueness. Several strategic approaches show potential:

  • Small molecule inhibitors: Developing compounds that selectively inhibit the catalytic activity of glpG by targeting the active site or allosteric regions.

  • Substrate-mimetic peptides: Creating modified peptides that resemble natural substrates but resist cleavage, thereby competitively inhibiting the enzyme.

  • Structure-based drug design: Leveraging the known amino acid sequence (mLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRVELARFIENPGDPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVmLACVVVYIAMSLIGDQTVMVWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVASWFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT) to identify unique structural features for targeting .

  • Combination approaches: Using glpG inhibitors alongside conventional antibiotics to enhance efficacy or overcome resistance mechanisms.

The development pipeline typically progresses through:

  • High-throughput screening of compound libraries

  • Validation in reconstituted enzyme systems

  • Testing in bacterial culture models

  • Evaluation in human infection models

How can Big Data approaches enhance research on Recombinant Salmonella paratyphi A Rhomboid protease glpG?

Effective Big Data implementation for rhomboid protease research involves:

  • Retrospective designed sampling: Rather than analyzing all available data, researchers can apply optimal experimental design principles retrospectively to select the most informative subset of data points. This approach has shown that analyzing carefully selected subsets (~25% of total data) can provide nearly equivalent statistical power to full dataset analysis .

  • Dimension reduction techniques: These methods help identify the most relevant variables and relationships in complex datasets, particularly useful when analyzing protease-substrate interactions across multiple conditions.

  • Integration of heterogeneous data types: Combining structural, functional, genomic, and clinical data to develop comprehensive models of protease function and regulation.

Table 2: Comparison of Data Analysis Approaches for Protein Function Studies

Covariance StructureFull Dataset AnalysisRandom SubsettingDesigned Subsetting
No correlation(-0.98, 0.28, 0.08)Variable(-0.98, 0.28, 0.08)
Positive correlation(-1.02, 0.30, 0.08)Less precise(-1.02, 0.30, 0.08)
Negative correlation(-1.00, 0.29, 0.08)Less precise(-1.00, 0.29, 0.08)

The table demonstrates that designed subsetting approaches can achieve parameter estimates very close to those obtained from full dataset analysis, while random subsetting produces more variable results .

What computational methods are most effective for analyzing structure-function relationships in Recombinant Salmonella paratyphi A Rhomboid protease glpG?

Analyzing structure-function relationships in Recombinant Salmonella paratyphi A Rhomboid protease glpG requires sophisticated computational approaches that can address the complexity of membrane protein dynamics. Several methodological approaches have proven particularly valuable:

  • Molecular dynamics simulations: These provide insights into protein motion within the membrane environment, particularly important for understanding how rhomboid proteases access and cleave their transmembrane substrates.

  • Homology modeling and evolutionary analysis: Comparing glpG sequences across bacterial species helps identify conserved regions critical for function versus variable regions that may confer substrate specificity.

  • Docking studies: Computational prediction of protein-substrate interactions helps identify key residues involved in substrate recognition and binding.

  • Machine learning approaches: When applied to large datasets of mutagenesis results or activity assays, these can identify non-obvious patterns in structure-function relationships.

For effective implementation, researchers should:

  • Validate computational predictions with experimental data

  • Consider membrane environment effects on protein structure and dynamics

  • Implement appropriate statistical frameworks for evaluating prediction accuracy

  • Utilize optimal experimental design principles to guide which computational hypotheses to test experimentally

This integration of computational and experimental approaches has proven particularly powerful for membrane proteins like rhomboid proteases, where traditional structural biology methods face significant technical challenges.

What are the most promising future research directions for Recombinant Salmonella paratyphi A Rhomboid protease glpG?

Future research on Recombinant Salmonella paratyphi A Rhomboid protease glpG is poised to advance in several innovative directions that combine emerging technologies with deeper mechanistic understanding:

  • High-resolution structural studies: Utilizing advanced cryo-electron microscopy and X-ray crystallography techniques to resolve the complete three-dimensional structure of glpG in various conformational states.

  • Substrate identification studies: Comprehensive proteomics approaches to identify the complete substrate repertoire of glpG in Salmonella paratyphi A, providing insights into its functional roles.

  • Integration with human challenge models: Combining in vitro studies of glpG with controlled human infection models to correlate molecular mechanisms with clinical outcomes. Current human challenge models using the NVGH308 strain provide a platform for such translational studies .

  • Systems biology approaches: Placing glpG function within the broader context of bacterial regulatory networks and host-pathogen interactions through multi-omics integration.

  • Application of optimal experimental design principles: Implementing modern decision theoretic approaches to maximize information gain while minimizing experimental resource expenditure, particularly important for complex in vivo studies .

These directions collectively address the major challenges in the field: connecting molecular mechanisms to physiological roles, developing effective inhibitors, and understanding the contribution of glpG to bacterial pathogenesis.

How might advancements in human infection models contribute to understanding rhomboid proteases in Salmonella pathogenesis?

Advancements in human infection models represent a significant opportunity for deeper understanding of rhomboid proteases in Salmonella pathogenesis. These models overcome the limitations of animal systems, which poorly recapitulate human-specific aspects of infection .

Current human challenge models for Salmonella Paratyphi A have established several important parameters:

  • An optimal infectious dose that achieves 60-75% attack rate

  • Defined clinical endpoints including sustained fever (>38°C for ≥12 hours)

  • Microbiological confirmation through blood culture positivity

  • A 14-day follow-up period before antibiotic administration in non-diagnosed cases

Future refinements of these models could include:

  • Genetically modified challenge strains: Creating Salmonella Paratyphi A strains with modified glpG to directly assess its contribution to infection dynamics.

  • Biomarker identification: Correlating glpG activity with specific host response patterns to develop diagnostic or prognostic indicators.

  • Interventional studies: Testing potential glpG inhibitors in controlled human infection settings to provide early proof-of-concept for therapeutic approaches.

  • Host-pathogen interaction analysis: Examining how bacterial factors including rhomboid proteases interact with host systems during actual human infection.

These approaches would provide unprecedented insights into the role of rhomboid proteases in actual human disease, bridging the gap between laboratory studies and clinical applications.

What are the key practical considerations for researchers working with Recombinant Salmonella paratyphi A Rhomboid protease glpG?

Researchers working with Recombinant Salmonella paratyphi A Rhomboid protease glpG should consider several practical aspects to maximize experimental success and data quality:

  • Protein stability management: The protein should be stored in Tris-based buffer with 50% glycerol at -20°C for routine storage or -80°C for extended preservation. Working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw degradation .

  • Experimental design optimization: Implementing optimal experimental design principles can significantly improve statistical power while reducing required sample sizes. Sequential design approaches that adapt based on accumulated data are particularly effective for complex biological systems .

  • Appropriate controls: Given the membrane-associated nature of rhomboid proteases, experiments require carefully designed controls to distinguish specific activity from non-specific membrane effects.

  • Statistical analysis considerations: When analyzing data from rhomboid protease experiments, the covariance structure of predictors should be considered as it can impact the efficiency of design-based approaches .

  • Ethical and regulatory framework: For studies involving human samples or infection models, researchers must navigate complex ethical considerations and regulatory requirements to ensure participant safety while advancing scientific understanding .

By addressing these practical considerations, researchers can maximize the value of their work with Recombinant Salmonella paratyphi A Rhomboid protease glpG while minimizing resource expenditure and experimental variability.

How should researchers interpret and reconcile conflicting data about Recombinant Salmonella paratyphi A Rhomboid protease glpG function?

When faced with conflicting data about Recombinant Salmonella paratyphi A Rhomboid protease glpG function, researchers should implement a systematic approach to data reconciliation that considers multiple factors:

  • Methodological differences: Variations in experimental conditions (detergent systems, buffer composition, temperature) can significantly impact rhomboid protease activity and lead to apparently conflicting results.

  • Statistical considerations: Applying optimal experimental design principles can help distinguish real effects from statistical artifacts, particularly when working with high-dimensional data or complex experimental systems .

  • Biological context: Results from in vitro systems may differ from those in cellular contexts or human infection models due to differences in membrane composition, presence of cofactors, or regulatory mechanisms .

  • Data integration approaches: Statistical methods that combine evidence across multiple studies while accounting for study-specific biases can help resolve apparent contradictions.

  • Systematic validation: Critical findings should be validated using complementary methodological approaches and in different experimental systems to establish robustness.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.