Recombinant Salmonella paratyphi A sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

Shipped with Ice Packs
In Stock

Description

Biological Role and Functional Insights

UgpA is a critical component of the ugp operon, which is transcriptionally activated during phosphate starvation . This system enables Salmonella Paratyphi A to internalize G3P, a process vital for:

  • Nutrient acquisition: G3P serves as a carbon and phosphorus source in low-phosphate environments .

  • Intracellular survival: The ugp operon is upregulated during epithelial cell infection, suggesting a role in host-pathogen interactions .

Functional parameters (based on homologous systems in Salmonella Typhimurium):

  • Transport kinetics:

    • Apparent KmK_m: 50 µM (G3P) .

    • VmaxV_{max}: 2.2 nmol/min/10⁸ cells .

  • Genetic regulation: Co-expressed with ugpB and ugpC under PhoB/PhoR regulatory control .

Production and Purification

The recombinant UgpA protein is produced in E. coli using codon-optimized expression systems . Key steps include:

  1. Cloning: The ugpA gene is inserted into plasmid vectors (e.g., pACYC184) under strong promoters .

  2. Expression: Induced via IPTG, yielding cytoplasmic membrane-localized protein .

  3. Purification: Affinity chromatography using nickel-NTA resins to capture the His-tagged protein .

Quality control:

  • Purity validated by SDS-PAGE (>85%) .

  • Identity confirmed via mass spectrometry and N-terminal sequencing .

Research Applications

Recombinant UgpA is utilized in:

  • Mechanistic studies: Elucidating ABC transporter dynamics and substrate specificity .

  • Pathogenesis research: Investigating ugp operon contributions to intracellular survival and virulence .

  • Antimicrobial target discovery: Screening for inhibitors targeting G3P uptake pathways .

Future Directions

While current studies focus on biochemical characterization, further work is needed to:

  • Resolve the crystal structure of UgpA to guide drug design.

  • Validate its role in Salmonella Paratyphi A pathogenicity using knockout models.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference for your application.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid protein has a shelf life of 6 months at -20°C/-80°C. Lyophilized protein has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
ugpA; SPA3408; sn-glycerol-3-phosphate transport system permease protein UgpA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
ugpA
Target Protein Sequence
MSSFRPVFRSRWLPYLLVAPQLVITVIFFIWPAGEALWYSLQSVDPFGFSSQFVGLENFV ALFHDSYYLDAFWTTIKFSALVTFSGLLVSLFFAALVDYVVRGSRFYQTLMLLPYAVAPA VAAVLWIFLFNPGRGLITHFLGEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFFAA LQSIPRSLVEAAAIDGAGPIRRFFRLSLPLIAPVSFFLLVVNLVYAFFDTFPVIDAATAG GPVQATTTLIYKIYREGFTGLDLSASAAQSVVLMFLVIILTVVQFRYVESKVRYQ
Uniprot No.

Target Background

Function
This protein is part of the binding-protein-dependent transport system for sn-glycerol-3-phosphate. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: spt:SPA3408

Protein Families
Binding-protein-dependent transport system permease family, UgpAE subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ugp transport system and what role does ugpA play within it?

The ugp-dependent transport system is specifically designed for the uptake of sn-glycerol-3-phosphate in bacteria. It becomes activated under phosphate starvation conditions and in mutants constitutive for the pho regulon . Within this system, ugpA functions as a permease protein, forming part of the membrane-spanning component that facilitates the actual transport of sn-glycerol-3-phosphate across the cell membrane. The system's functionality depends on periplasmic binding proteins, which are necessary but not sufficient for transport activity .

The mechanism involves initial capture of sn-glycerol-3-phosphate by a periplasmic binding protein, followed by interaction with membrane components including ugpA to transport the substrate into the cell. Research has demonstrated that the system does not operate in membrane vesicles and is highly sensitive to osmotic shock, which indicates its dependence on intact cellular architecture and binding protein availability .

How is the ugp transport system regulated in Salmonella species?

The ugp transport system is primarily regulated as part of the pho regulon, which responds to phosphate limitation in the environment . Under phosphate starvation conditions, the system is induced, allowing bacteria to utilize alternative phosphate sources. This regulation occurs at the transcriptional level, with specific regulatory proteins controlling gene expression in response to environmental phosphate levels.

In experimental settings, researchers can observe this regulation by culturing bacteria under varying phosphate concentrations and measuring the expression of ugp genes. Studies have demonstrated that mutants constitutive for the pho regulon exhibit constant expression of the ugp transport system regardless of phosphate availability . The system's integration with cellular phosphate sensing mechanisms ensures that bacteria can efficiently manage their phosphate resources under varying environmental conditions.

What are the primary methodologies for isolating and characterizing ugpA in Salmonella paratyphi A?

Isolation and characterization of ugpA in S. paratyphi A typically involves a multi-step approach. Initially, PCR amplification of the ugpA gene using specific primers designed from conserved regions of the gene sequence is performed. This is followed by cloning the amplified product into an appropriate expression vector. For example, similar approaches with other Salmonella proteins have utilized prokaryotic expression vectors to produce recombinant proteins .

For protein expression, E. coli strains such as BL21(DE3) are commonly used as host cells, with expression induced using IPTG (Isopropyl β-D-1-thiogalactopyranoside). The recombinant protein can then be purified using affinity chromatography if a tag (such as His-tag) is incorporated into the construct. Characterization typically involves:

  • SDS-PAGE to confirm molecular weight

  • Western blotting for specific identification

  • Functional assays to assess transport activity

  • Structural analysis using techniques such as X-ray crystallography or cryo-EM

Similar methodological approaches have been successfully applied to other Salmonella proteins like SpaO and H1a, where PCR and sequencing analysis were used to establish gene distribution and conservation across clinical isolates .

How does experimental design impact the study of ugpA function in phosphate transport?

Experimental design critically influences the validity and reliability of ugpA functional studies. When investigating ugpA's role in phosphate transport, researchers must carefully control several variables, including phosphate concentration in growth media, expression levels of other ugp operon components, and potential confounding variables such as alternate phosphate transport systems .

A robust experimental design should include:

  • Independent variables: These might include ugpA expression levels, phosphate concentration, or presence of competitive inhibitors.

  • Dependent variables: Typically measured as transport rates of radiolabeled sn-glycerol-3-phosphate or phosphate utilization metrics.

  • Control for extraneous variables: Including genetic backgrounds, growth conditions, and elimination of confounding alternate transport systems .

Randomization is particularly important when evaluating multiple strains or conditions to eliminate systematic biases . For example, when evaluating the impact of ugpA mutations on phosphate transport, researchers should randomize the order of strain testing and measurement to prevent time-dependent artifacts.

Appropriate control strains are essential, including:

  • Wild-type strains with natural ugpA expression

  • Complete deletion mutants lacking ugpA

  • Complementation strains where ugpA is reintroduced to confirm phenotype restoration

What are the challenges in resolving contradictory data regarding ugpA substrate specificity?

Resolving contradictory data regarding ugpA substrate specificity requires a systematic approach to identify sources of experimental variability. Researchers have observed apparently conflicting results regarding whether sn-glycerol-3-phosphate transported via the ugp system can be utilized as both a carbon and phosphate source .

To address such contradictions, consider the following methodological approaches:

  • Strain-specific variations: Different Salmonella strains may have varying metabolic capabilities. Comparative studies using identical methodologies across multiple strains can identify strain-specific effects.

  • Growth condition dependencies: Research has demonstrated that while cells with high ugp-dependent transport activity cannot use sn-glycerol-3-phosphate as a sole carbon source, they can incorporate it into phospholipids and other cellular components when an alternate carbon source is available . This illustrates how experimental conditions can generate apparently contradictory results.

  • Cross-validation with multiple techniques: Use complementary approaches such as:

    • Transport assays using radiolabeled substrates

    • Growth phenotyping under various nutrient limitations

    • Metabolic labeling studies to track substrate utilization

  • Genetic manipulation: Construction of strains with controlled genetic backgrounds can eliminate variables. For example, strains lacking alkaline phosphatase, glycerol kinase, and constitutive for the glp regulon have been used to specifically investigate ugp transport without interference from other metabolic pathways .

The table below summarizes the approach to resolving contradictory data:

Contradiction SourceInvestigation ApproachExpected Outcome
Strain variationCompare multiple strains with identical methodsIdentification of strain-specific effects
Growth conditionsTest multiple media formulations with varying carbon/phosphate sourcesDetermination of condition-dependent behavior
Assay limitationsApply multiple complementary techniquesComprehensive understanding of substrate utilization
Genetic backgroundCreate strains with defined genetic modificationsIsolation of specific ugpA effects

How can researchers effectively design mutation studies to elucidate the structure-function relationship of ugpA?

Designing effective mutation studies for ugpA requires a strategic approach based on protein structural information and evolutionary conservation. The structure-function relationship can be systematically explored through the following methodological steps:

  • Sequence alignment analysis: Identify conserved residues across ugpA homologs from different species, which often indicate functional importance. Similar approaches applied to other Salmonella proteins have revealed high sequence conservation (99.31-99.88% similarity) .

  • Targeted mutagenesis strategies:

    • Alanine scanning: Systematically replacing amino acids with alanine to identify essential residues

    • Conservative vs. non-conservative substitutions: Replacing residues with chemically similar or dissimilar amino acids to probe specific chemical properties

    • Domain swapping: Exchanging domains between related permeases to identify functional regions

  • Functional assessment of mutants:

    • Transport activity assays using radiolabeled substrates

    • Binding affinity measurements

    • In vivo complementation studies

  • Structural validation:

    • Membrane protein crystallography or cryo-EM to confirm structural impacts

    • Molecular dynamics simulations to predict effects of mutations

When designing such studies, researchers must carefully consider the membrane-embedded nature of ugpA, which presents specific challenges for expression, purification, and functional assessment. Selection methods that have proven effective include identifying resistance to toxic analogs that are transported by the system, such as 3,4-dihydroxybutyl-1-phosphonate .

What are the optimal expression systems for producing recombinant ugpA protein for structural and functional studies?

The optimal expression systems for recombinant ugpA production must address the challenges inherent to membrane protein expression. Several systems offer distinct advantages depending on research objectives:

  • E. coli-based expression systems:

    • BL21(DE3) strains with pET vectors provide high-level expression under IPTG induction

    • C41(DE3) and C43(DE3) strains are specifically engineered for membrane protein expression

    • Fusion partners such as MBP (maltose-binding protein) can improve solubility and folding

  • Cell-free expression systems:

    • Allow direct incorporation into nanodiscs or liposomes

    • Avoid toxicity issues associated with membrane protein overexpression

    • Enable selective labeling for structural studies

  • Yeast expression systems:

    • Pichia pastoris provides a eukaryotic environment with prokaryotic ease of manipulation

    • Better suited for complex folding requirements than E. coli

For optimal production, consider these methodological parameters:

  • Induction conditions: Lower temperatures (16-25°C) often improve proper folding

  • Detergent selection: Critical for extraction and maintaining protein stability

  • Purification approach: Affinity tags should be positioned to avoid interference with function

Similar approaches have been successfully applied to recombinant Salmonella antigens like SpaO and H1a, where prokaryotic expression systems were used to generate immunogens for functional studies and vaccination experiments .

How can researchers validate the functional integrity of recombinant ugpA protein?

Validating the functional integrity of recombinant ugpA requires multiple complementary approaches to ensure that the protein retains its native structure and activity. Comprehensive validation should include:

  • Biochemical validation:

    • Size-exclusion chromatography to confirm proper oligomerization

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal stability assays to evaluate protein folding quality

  • Functional validation:

    • Reconstitution into liposomes or proteoliposomes for transport assays

    • Substrate binding assays using isothermal titration calorimetry or surface plasmon resonance

    • ATPase activity measurements if applicable to the transport mechanism

  • Immunological validation:

    • Western blot analysis using antibodies against native ugpA

    • Slide agglutination tests similar to those used for other Salmonella recombinant proteins

  • Genetic complementation:

    • Expression of recombinant ugpA in ugpA-deficient strains should restore transport function

    • Transport of sn-glycerol-3-phosphate can be measured using radiolabeled substrates

The most definitive validation comes from demonstrating that the recombinant protein can restore function in a genetic knockout background. This approach has been successfully used with other transporters, where the incorporation of radiolabeled substrates into cellular components like phospholipids served as functional confirmation .

What high-throughput screening methods can identify inhibitors or modulators of ugpA function?

High-throughput screening (HTS) for ugpA inhibitors or modulators requires specialized approaches due to the challenges of working with membrane transport proteins. Effective HTS methods include:

  • Whole-cell-based screening approaches:

    • Growth-based assays measuring bacterial survival under conditions requiring ugp transport

    • Reporter gene assays where ugpA function is linked to fluorescent or luminescent output

    • Transport assays using fluorescent substrate analogs

  • Biochemical screening approaches:

    • ATPase activity assays if ugpA function is coupled to ATP hydrolysis

    • Binding assays using fluorescence polarization or FRET

    • Thermal shift assays to identify compounds that alter protein stability

  • Computational screening approaches:

    • Virtual screening against predicted binding sites

    • Molecular dynamics simulations to identify potential allosteric sites

    • Machine learning models trained on known transporter inhibitors

Data analysis for HTS requires robust statistical methods:

Screening ParameterStatistical ApproachThreshold
Hit identificationZ-score calculationZ > 3 considered significant
False positive filteringConfirmation in secondary assays≥ 75% replication rate
Structure-activity relationshipClustering by chemical scaffolds≥ 3 related compounds showing activity
Selectivity assessmentCounter-screening against related transporters≥ 10-fold selectivity

Follow-up validation should include more detailed functional studies, such as measuring the effect on sn-glycerol-3-phosphate transport under various conditions and determining the mechanism of inhibition. This approach mirrors selection methods used for identifying transport mutants, where resistance to toxic analogs has proven effective .

How does ugpA contribute to Salmonella paratyphi A pathogenesis and survival during infection?

Understanding ugpA's contribution to S. paratyphi A pathogenesis represents a critical research frontier. While direct evidence for ugpA in S. paratyphi A virulence is still emerging, insights can be gained by examining the role of phosphate acquisition systems in bacterial pathogenesis more broadly.

The ugp transport system is induced under phosphate starvation conditions , which bacteria often encounter within host environments due to nutritional immunity—the host's restriction of essential nutrients as a defense mechanism. Phosphate limitation within host tissues may trigger upregulation of the ugp system, potentially enhancing bacterial survival.

Key research directions include:

  • Host-pathogen interface studies:

    • Examining ugpA expression during different stages of infection

    • Determining if ugpA is upregulated in specific host niches

    • Investigating if host factors directly influence ugp regulation

  • Virulence contribution assessment:

    • Constructing ugpA knockout strains and testing virulence in animal models

    • Competitive index experiments comparing wild-type and ugpA mutants

    • Transcriptomic analysis of ugpA expression patterns during infection

  • Immunological studies:

    • Investigating whether ugpA is recognized by the host immune system

    • Determining if anti-ugpA antibodies are produced during natural infection

    • Assessing if ugpA could serve as an immunogen similar to other S. paratyphi A antigens like SpaO and H1a

Recent research on S. paratyphi A immunogens has demonstrated that recombinant proteins can induce protective immune responses, with combination approaches yielding higher protection rates (75.0-91.7%) compared to single antigens (41.7-66.7%) . Similar approaches could be applied to investigate ugpA's potential as an immunogen or virulence factor.

What is the potential of ugpA as a target for novel antimicrobial development?

The potential of ugpA as an antimicrobial target merits systematic exploration based on several key factors:

  • Essentiality assessment:

    • Determine if ugpA is essential for S. paratyphi A survival under various conditions

    • Evaluate growth kinetics of ugpA mutants in phosphate-limited environments

    • Assess colonization ability of ugpA mutants in infection models

  • Structural targetability:

    • Identify binding pockets suitable for small molecule inhibition

    • Evaluate conservation of potential binding sites across pathogens

    • Conduct structure-based design of potential inhibitors

  • Selectivity considerations:

    • Compare sequence and structural differences between bacterial and human phosphate transporters

    • Identify bacterial-specific features that could be selectively targeted

    • Design screening assays that prioritize compounds with selective activity

  • Resistance development assessment:

    • Evaluate the frequency of spontaneous resistance to potential ugpA inhibitors

    • Characterize mechanisms of resistance through whole-genome sequencing

    • Develop combination approaches to mitigate resistance potential

The ugp system's role in phosphate acquisition under starvation conditions suggests it may be particularly important during infection . Compounds that selectively inhibit ugpA function could potentially disrupt bacterial phosphate homeostasis during host colonization. Selection methods using toxic analogs transported by the system, such as 3,4-dihydroxybutyl-1-phosphonate, provide a foundation for inhibitor development strategies .

How can systems biology approaches enhance our understanding of ugpA's role in the broader phosphate regulatory network?

Systems biology approaches offer powerful frameworks for contextualizing ugpA within the broader phosphate regulatory network of S. paratyphi A. Such integrated approaches can reveal emergent properties not evident from studying individual components:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data to map the phosphate regulon

    • Identify co-regulated genes and proteins that function alongside ugpA

    • Characterize metabolic flux changes resulting from ugpA perturbation

  • Network analysis:

    • Construct protein-protein interaction networks centered on ugpA

    • Map regulatory networks controlling ugpA expression

    • Identify feedback loops and regulatory motifs in phosphate homeostasis

  • Mathematical modeling:

    • Develop kinetic models of phosphate transport via the ugp system

    • Create whole-cell models incorporating phosphate utilization pathways

    • Simulate bacterial responses to environmental phosphate fluctuations

  • Evolutionary systems biology:

    • Compare ugp systems across bacterial species to identify conserved and divergent features

    • Reconstruct the evolutionary history of phosphate acquisition mechanisms

    • Identify selective pressures shaping ugpA structure and function

Experimental validation of systems-level hypotheses can employ techniques such as:

  • CRISPRi for targeted gene expression modulation

  • Phosphate flux measurements using radioactive or stable isotope labeling

  • In vivo imaging of phosphate distribution in bacterial cells

The ugp system's relationship with other phosphate acquisition mechanisms creates a complex regulatory network. Research has shown that the system is induced under phosphate starvation and in mutants constitutive for the pho regulon , indicating integration with global phosphate sensing mechanisms that could be comprehensively mapped using systems approaches.

What are the critical knowledge gaps in ugpA research that require immediate attention?

Despite progress in understanding bacterial phosphate transport systems, several critical knowledge gaps concerning ugpA in Salmonella paratyphi A require focused research attention. The most pressing areas include:

  • Structural characterization: While the function of ugpA has been inferred from homologous systems, high-resolution structural data specifically for S. paratyphi A ugpA is lacking. Such information is essential for understanding its mechanism and developing targeted interventions.

  • Host-pathogen interactions: The role of ugpA during actual infection remains poorly characterized. Research combining in vivo infection models with techniques like RNA-seq could reveal how ugpA expression changes during different infection stages and its contribution to virulence.

  • Regulatory network integration: While ugpA is known to be part of the pho regulon , the complete regulatory network controlling its expression in S. paratyphi A specifically needs further elucidation, including potential cross-talk with virulence regulation systems.

  • Clinical relevance: The presence of ugpA in clinical isolates and its conservation pattern across S. paratyphi A strains requires systematic investigation similar to studies conducted for other S. paratyphi A antigens, which have shown high conservation rates (99.31-99.88%) .

  • Functional redundancy: The degree to which other phosphate transport systems can compensate for ugpA deficiency under various conditions remains unclear, affecting its viability as a therapeutic target.

Addressing these knowledge gaps will require collaborative approaches combining structural biology, molecular genetics, infection biology, and systems-level analyses. The methodologies successfully applied to other S. paratyphi A proteins, including PCR, sequencing analysis, and recombinant protein expression , provide a framework for tackling these challenges.

How might future technological advances impact ugpA research?

Emerging technologies are poised to transform ugpA research in the coming years, accelerating discovery and enabling previously infeasible experiments. Key technological frontiers include:

  • Structural biology advancements:

    • Cryo-EM improvements allowing membrane protein structures at near-atomic resolution without crystallization

    • Integrative structural biology combining multiple data types for complete models

    • AI-powered structure prediction specifically optimized for membrane proteins

  • Genetic engineering innovations:

    • CRISPR-based methods for precise genome editing in Salmonella species

    • Synthetic biology approaches for creating minimal cells with defined phosphate transport systems

    • Optogenetic control of ugpA expression for temporal studies

  • Single-cell technologies:

    • Single-cell transcriptomics to reveal population heterogeneity in ugpA expression

    • Microfluidic systems for tracking individual bacterial responses to phosphate limitation

    • Super-resolution microscopy for visualizing ugpA localization and dynamics

  • Computational advances:

    • Molecular dynamics simulations at extended timescales capturing complete transport cycles

    • Machine learning approaches for predicting transport substrates and inhibitors

    • Systems biology models integrating multiple scales from molecular to population levels

These technological advances will enable researchers to address fundamental questions about ugpA with unprecedented precision and comprehensiveness. The combination of structural insights, functional characterization, and systems-level understanding will provide a complete picture of ugpA's role in bacterial physiology and pathogenesis, potentially revealing new approaches for therapeutic intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.