Recombinant Salmonella paratyphi A Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdtI; SPA1371; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
mdtI
Target Protein Sequence
MQQFEWIHGAWLGLAIVLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA
Uniprot No.

Target Background

Function

Catalyzes the excretion of spermidine.

Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MdtI and what role does it play in Salmonella Paratyphi A?

MdtI is a spermidine export protein belonging to the small multidrug resistance (SMR) family of drug exporters in Salmonella species, including S. Paratyphi A. It functions primarily to export spermidine, a polyamine that can become toxic when overaccumulated within bacterial cells. MdtI does not function alone but forms a complex with another protein called MdtJ (together forming the MdtJI complex) to effectively catalyze the excretion of spermidine from cells. This protein complex plays a significant role in polyamine homeostasis, which is crucial for various cellular processes including cell growth, proliferation, and stress response. The mdtI gene expression is upregulated in response to elevated spermidine levels, suggesting a regulatory mechanism that responds to polyamine concentration within the cell .

How is the function of MdtI experimentally determined in laboratory settings?

The function of MdtI is typically determined through complementation studies in bacteria deficient in spermidine metabolism. The methodological approach involves:

  • Creating a strain deficient in spermidine acetyltransferase (an enzyme that metabolizes spermidine)

  • Introducing plasmids expressing MdtI (such as pUCmdtJI or pMWmdtJI)

  • Measuring cell toxicity and growth inhibition in the presence of high spermidine concentrations

  • Quantifying intracellular spermidine content in cells cultured with exogenous spermidine (e.g., 2 mM)

  • Measuring spermidine excretion rates from cells

Research has demonstrated that both mdtJ and mdtI genes are necessary for cells to recover from spermidine toxicity. When cells are cultured in the presence of 2 mM spermidine, those expressing the MdtJI complex show decreased intracellular spermidine content and enhanced spermidine excretion compared to control cells, confirming the role of this complex in spermidine export .

What amino acid residues are essential for MdtI function?

The functional activity of MdtI is dependent on specific amino acid residues that have been identified through site-directed mutagenesis studies. In MdtI, the critical residues include:

PositionAmino AcidProposed Function
5Glutamate (Glu5)Likely involved in substrate recognition or binding
19Glutamate (Glu19)May participate in proton coupling mechanism
60Aspartate (Asp60)Potentially forms part of the transport channel
68Tryptophan (Trp68)May contribute to substrate binding pocket
81Tryptophan (Trp81)Likely involved in structural stability or transport mechanism

These amino acid residues are specifically involved in the excretion activity of the MdtJI complex. Mutagenesis of these residues significantly reduces the ability of the complex to export spermidine, leading to polyamine accumulation and increased cell toxicity in experimental systems. The acidic residues (Glu5, Glu19, and Asp60) may contribute to proton-coupled transport, while the aromatic tryptophan residues likely play a role in substrate recognition or binding pocket formation .

What expression systems are most effective for producing recombinant MdtI for structural and functional studies?

For recombinant MdtI production, several expression systems have been employed with varying degrees of success:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coliHigh yield, cost-effective, rapid growthMay form inclusion bodies, requires optimization for membrane proteins1-5 mg/L culture
YeastBetter for eukaryotic post-translational modificationsSlower growth, more complex media requirements0.5-2 mg/L culture
BaculovirusExcellent for membrane proteinsMore expensive, technically demanding0.2-1 mg/L culture
Mammalian CellBest for complex proteins requiring specific foldingMost expensive, lowest yield0.1-0.5 mg/L culture

The methodological approach typically involves:

  • Cloning the mdtI gene (encoding amino acids 1-109 in S. Paratyphi A strain SL254) into an appropriate expression vector with an affinity tag

  • Transforming the expression host with the recombinant plasmid

  • Optimizing expression conditions (temperature, inducer concentration, expression duration)

  • Cell lysis and membrane fraction isolation (as MdtI is a membrane protein)

  • Solubilization using appropriate detergents (e.g., DDM, LDAO, or C12E8)

  • Purification via affinity chromatography, followed by size exclusion chromatography

For functional studies, the recombinant protein should be reconstituted into proteoliposomes to measure transport activity. For structural studies, the protein must be maintained in a stable, homogeneous form suitable for techniques such as X-ray crystallography or cryo-electron microscopy .

How can researchers effectively design experiments to study the role of MdtI in antimicrobial resistance?

To investigate MdtI's role in antimicrobial resistance, researchers should implement a multi-faceted experimental approach:

  • Gene knockout and complementation studies:

    • Generate mdtI deletion mutants in Salmonella Paratyphi A

    • Complement with wild-type and mutant variants of mdtI

    • Test antimicrobial susceptibility using standardized methods (broth microdilution, disk diffusion)

  • Gene expression analysis:

    • Measure mdtI expression under different antibiotic stresses using qRT-PCR

    • Perform RNA-seq to identify co-regulated genes in response to antimicrobial exposure

    • Use reporter gene constructs (e.g., mdtI promoter fused to GFP) to visualize expression patterns

  • Protein interaction studies:

    • Identify protein partners beyond MdtJ using pull-down assays or bacterial two-hybrid systems

    • Characterize the stoichiometry of the MdtJI complex using analytical ultracentrifugation

    • Map interaction domains through truncation constructs and site-directed mutagenesis

  • Transport assays:

    • Measure spermidine transport in membrane vesicles containing recombinant MdtI

    • Assess competition with antibiotics to determine if they share the same export pathway

    • Evaluate transport kinetics under different pH and ion concentrations

Recent research indicates that there may be functional overlap between antibiotic resistance mechanisms and spermidine export, as many drug efflux pumps can transport multiple substrates. Understanding this relationship could provide insights into novel approaches to combat antimicrobial resistance in Salmonella Paratyphi A infections .

How can MdtI be utilized in the development of vaccines against Salmonella Paratyphi A?

MdtI can be incorporated into vaccine development strategies against Salmonella Paratyphi A through several research approaches:

Recent research on bivalent typhoidal vaccines has shown that OMV-based approaches can induce significant humoral and cellular immune responses against Salmonella Typhi and Paratyphi A. In one study, mice immunized with OMVs exhibited increased CD4, CD8, and CD19 cell populations in the spleen and developed Th1 and Th17-cell mediated immunity, which was protective against heterologous Salmonella strains. These findings suggest that membrane proteins like MdtI could contribute to protective immunity when incorporated into OMV-based vaccines .

What immunological considerations are important when developing MdtI-based vaccine components?

When developing MdtI-based vaccine components, researchers must address several critical immunological considerations:

  • Epitope identification and optimization:

    • Perform computational epitope prediction to identify immunogenic regions of MdtI

    • Validate predicted epitopes using synthetic peptides in T-cell activation assays

    • Consider epitope conservation across different strains of S. Paratyphi A

  • Immune response characterization:

    • Evaluate both humoral (antibody-mediated) and cellular immune responses

    • Measure specific antibody isotypes (IgG, IgA) in serum and mucosal secretions

    • Assess T-cell responses through cytokine profiling (IFN-γ, IL-17, IL-4)

  • Cross-protection potential:

    • Determine if MdtI-induced immunity offers protection against other Salmonella serovars

    • Evaluate cross-reactivity with homologous proteins in other enteric pathogens

    • Assess potential for epitope spreading to other bacterial antigens

  • Safety considerations:

    • Ensure MdtI components do not induce autoimmune responses

    • Evaluate the risk of immunological tolerance instead of protective immunity

    • Monitor for immunopathological reactions in animal models

Current research indicates that effective vaccines against enteric fever require induction of both Th1 and Th17-cell mediated immunity. Studies have shown that OMV-based immunization significantly induces these responses and can prevent infection from heterologous Salmonella strains. The protective immune response depends on a combination of humoral and cell-mediated immunity, with anti-OMV antibodies shown to inhibit bacterial motility and mucin penetration ability—key virulence mechanisms in Salmonella infection .

How does the structure of MdtI contribute to its function as a spermidine export protein?

The structure-function relationship of MdtI is critical to understanding its mechanism of spermidine export. Based on current research:

MdtI belongs to the Small Multidrug Resistance (SMR) family and consists of 109 amino acids in Salmonella Paratyphi A strain SL254. The protein contains approximately four transmembrane α-helical domains that span the bacterial membrane. The structural elements that contribute to its function include:

  • Transmembrane topology:

    • Four transmembrane domains create a channel-like structure

    • The N and C termini are located on opposite sides of the membrane

    • The second and third transmembrane domains likely form the substrate translocation pathway

  • Key functional regions:

    • Substrate binding pocket formed by hydrophobic and aromatic residues

    • Proton-coupling elements involving conserved acidic residues

    • Dimerization interface that mediates interaction with MdtJ

  • Critical amino acid residues:

    • Glu5, Glu19, and Asp60 likely participate in proton-dependent transport

    • Trp68 and Trp81 form part of the substrate recognition site

    • Hydrophobic residues in transmembrane domains facilitate dimerization with MdtJ

Functional studies have demonstrated that MdtI must form a complex with MdtJ to create a functional spermidine exporter. The heterodimeric nature of this complex provides specificity for spermidine transport, as neither protein alone is sufficient for export activity. Mutagenesis of the key residues (Glu5, Glu19, Asp60, Trp68, and Trp81) significantly reduces transport activity, confirming their importance in the export mechanism .

What advanced techniques are being used to characterize the MdtI-MdtJ interaction and its impact on spermidine export?

Researchers are employing several sophisticated techniques to characterize the MdtI-MdtJ interaction and its functional implications:

  • Structural biology approaches:

    • X-ray crystallography of the purified MdtJI complex

    • Cryo-electron microscopy to visualize the complex in different conformational states

    • NMR spectroscopy to identify dynamic protein-protein interactions

    • Molecular dynamics simulations to predict conformational changes during transport

  • Biophysical interaction analysis:

    • Förster resonance energy transfer (FRET) to measure protein-protein interactions in vitro

    • Surface plasmon resonance (SPR) to determine binding kinetics and affinity

    • Isothermal titration calorimetry (ITC) to quantify thermodynamic parameters of the interaction

    • Analytical ultracentrifugation to determine complex stoichiometry

  • Functional transport assays:

    • Fluorescent spermidine analogs to track transport in real-time

    • Liposome reconstitution assays with purified MdtI and MdtJ proteins

    • Electrophysiological measurements to characterize transport channel properties

    • In vivo transport assays using radiolabeled spermidine

  • Genetic and proteomic approaches:

    • Site-directed mutagenesis to map interaction interfaces

    • Crosslinking studies to capture transient interactions

    • Hydrogen-deuterium exchange mass spectrometry to identify interaction surfaces

    • Chimeric protein construction to determine domain-specific functions

Research has revealed that both MdtI and MdtJ are necessary for spermidine export, as cells lacking either protein exhibit similar phenotypes regarding spermidine sensitivity. The level of mdtJI mRNA increases in response to elevated spermidine concentrations, suggesting a regulatory mechanism that connects expression to substrate availability. The spermidine content in cells expressing the MdtJI complex is significantly reduced when cultured in high spermidine concentrations, confirming the functional role of this complex in spermidine export .

How does MdtI in Salmonella Paratyphi A differ from homologous proteins in other bacterial species?

MdtI exhibits several important differences when compared to its homologs across bacterial species:

Bacterial SpeciesProtein HomologSequence IdentityFunctional DifferencesEvolutionary Implications
S. Paratyphi AMdtI100% (reference)Primary specificity for spermidineAdaptation to host environment
S. TyphiMdtI~98%Similar function, possibly different regulationConvergent evolution in human-adapted serovars
E. coliMdtI~85%Well-characterized spermidine exporterConserved function in Enterobacteriaceae
Other Salmonella serovarsMdtI variants90-99%Variable substrate specificityReflects host adaptation
Other Gram-negative bacteriaSMR family proteins40-70%Various polyamine and drug export functionsDiverse roles in different ecological niches

The functional differences between MdtI homologs likely reflect evolutionary adaptations to different ecological niches and host environments. In Salmonella Paratyphi A, MdtI might have evolved specific characteristics that contribute to pathogenesis and survival within the human host. The conservation of key functional residues (Glu5, Glu19, Asp60, Trp68, and Trp81) across species suggests their fundamental importance to the transport mechanism, while variations in other regions might account for differences in substrate specificity or regulatory control.

Detailed comparative genomic analyses have revealed the evolutionary trajectory of MdtI across bacterial species, with evidence suggesting that the gene has undergone selective pressure in host-adapted pathogens like S. Paratyphi A. These evolutionary insights may help explain the role of MdtI in Salmonella pathogenesis and host adaptation .

What is the relationship between MdtI function and antimicrobial resistance development in Salmonella Paratyphi A?

The relationship between MdtI function and antimicrobial resistance in Salmonella Paratyphi A is complex and multifaceted:

  • Direct contribution to antibiotic efflux:

    • While MdtI primarily exports spermidine, it belongs to the SMR family of drug exporters

    • Some SMR proteins have been shown to export certain antibiotics alongside their primary substrates

    • Research suggests potential overlap between polyamine export and extrusion of specific antimicrobial compounds

  • Indirect effects on resistance mechanisms:

    • Polyamine homeostasis affects membrane permeability and stability

    • Spermidine modulates biofilm formation, which can enhance antibiotic tolerance

    • Polyamines influence the expression of other resistance determinants

  • Relationship with persistent infection:

    • Recent studies highlight overlap between antibiotic persistence (AP), persistent infection (PI), and antimicrobial resistance (AMR)

    • MdtI may contribute to bacterial persistence by modulating intracellular polyamine levels

    • Persistent infections can create conditions favorable for the development of resistance

  • Evolutionary considerations:

    • The mdtI gene has evolved alongside other resistance determinants

    • Genomic analysis shows selective pressure on mdtI in antibiotic-resistant lineages

    • Horizontal gene transfer events may have influenced mdtI evolution in pathogenic strains

Research indicates that while most S. Paratyphi A isolates (98%) lack predicted antimicrobial resistance genes, the emergence of resistant strains has been documented. The complex interplay between polyamine homeostasis, stress response, and antimicrobial resistance suggests that MdtI may play both direct and indirect roles in the development of resistance phenotypes. Understanding these relationships could inform novel therapeutic strategies targeting polyamine transport systems in combination with conventional antibiotics .

What are the current technical challenges in studying MdtI and potential solutions?

Researchers face several significant technical challenges when studying MdtI, each requiring innovative methodological approaches:

  • Membrane protein expression and purification challenges:

    • Challenge: Low expression yields and protein instability during purification

    • Solutions:

      • Use specialized expression systems optimized for membrane proteins (C43(DE3) strain)

      • Employ fusion partners (MBP, SUMO) to enhance solubility

      • Develop nanodiscs or styrene-maleic acid copolymer lipid particles (SMALPs) for native-like environment preservation

      • Screen multiple detergents systematically for optimal extraction and stability

  • Functional characterization difficulties:

    • Challenge: Accurate measurement of spermidine transport activity

    • Solutions:

      • Develop fluorescent spermidine analogs for real-time transport assays

      • Establish proteoliposome-based transport systems with controlled internal environment

      • Implement electrophysiological techniques to measure transport at single-molecule level

      • Use isotope-labeled spermidine with sensitive detection methods

  • Structural analysis limitations:

    • Challenge: Obtaining high-resolution structures of the MdtJI complex

    • Solutions:

      • Combine cryo-EM with X-ray crystallography approaches

      • Apply computational modeling validated by cross-linking and mutagenesis data

      • Use hydrogen-deuterium exchange mass spectrometry to map protein dynamics

      • Implement single-particle analysis techniques optimized for small membrane protein complexes

  • In vivo relevance assessment:

    • Challenge: Connecting in vitro findings to physiological role in infection

    • Solutions:

      • Develop cell infection models that monitor MdtI activity during infection

      • Create reporter strains that indicate spermidine levels in real-time

      • Use animal models with tissue-specific spermidine measurement capabilities

      • Implement CRISPR-based genome editing for precise modification of mdtI in native context

Recent methodological advances in membrane protein science offer promising solutions to many of these challenges. Integrating multiple complementary approaches will be crucial for comprehensive characterization of MdtI structure, function, and physiological significance .

How might MdtI research contribute to novel therapeutic approaches against Salmonella Paratyphi A infections?

MdtI research has significant potential to inform innovative therapeutic strategies against Salmonella Paratyphi A infections through several promising avenues:

  • Direct inhibition of MdtI function:

    • Development of small molecule inhibitors targeting the MdtI-MdtJ complex

    • Design of peptidomimetics that disrupt the MdtI-MdtJ interaction interface

    • Creation of spermidine analogs that competitively inhibit export but cause intracellular toxicity

    • Screening of natural product libraries for specific MdtI inhibitors

  • Vaccine development incorporating MdtI:

    • Integration of MdtI epitopes into multi-component subunit vaccines

    • Use of MdtI-containing outer membrane vesicles (OMVs) as vaccine components

    • Development of DNA vaccines encoding modified MdtI for enhanced immunogenicity

    • Creation of attenuated live vaccines with regulated MdtI expression

  • Combination therapeutic approaches:

    • Co-administration of MdtI inhibitors with conventional antibiotics to enhance efficacy

    • Targeting multiple polyamine transporters simultaneously to prevent compensatory mechanisms

    • Developing dual-action molecules that inhibit both MdtI and other virulence factors

    • Creating drug delivery systems that specifically target bacteria expressing MdtI

  • Diagnostic applications:

    • Development of rapid detection methods for MdtI expression as markers of infection

    • Creation of biosensors that detect MdtI-mediated spermidine export

    • Implementation of gene-based diagnostics targeting mdtI sequence variants

    • Using anti-MdtI antibodies for immunodiagnostic applications

Current research suggests that understanding the interplay between antibiotic persistence, persistent infection, and antimicrobial resistance will be crucial for developing effective therapies. The recent BiVISTA clinical trials testing experimental vaccines against both S. Typhi and S. Paratyphi A represent significant progress in this direction. These trials use controlled human infection models to assess vaccine efficacy, with volunteers deliberately exposed to live bacteria after vaccination to evaluate protective immunity. This approach could be extended to test therapies targeting MdtI and related systems .

How does MdtI function integrate with broader bacterial physiological networks in Salmonella Paratyphi A?

MdtI function is intricately connected to multiple physiological networks within Salmonella Paratyphi A, creating a complex web of interactions:

  • Polyamine homeostasis network:

    • MdtI-MdtJ complex functions alongside polyamine biosynthetic enzymes (e.g., SpeA, SpeB, SpeC)

    • Coordinates with polyamine uptake systems (PotABCD, PotFGHI)

    • Interacts with polyamine modification systems (SpermidineN1-acetyltransferase)

    • Forms part of the polyamine stress response system

  • Stress response integration:

    • MdtI expression responds to various stress conditions (oxidative, pH, osmotic)

    • Expression is regulated by global stress response regulators (RpoS, PhoP/PhoQ)

    • Contributes to acid tolerance response necessary for gastric passage

    • Participates in mechanisms for host environment adaptation

  • Virulence regulation network:

    • Polyamine levels modulated by MdtI affect expression of virulence genes

    • Spermidine concentration influences motility and invasion capabilities

    • MdtI activity may affect biofilm formation during chronic infection

    • Polyamine homeostasis impacts survival within host macrophages

  • Metabolic integration:

    • Connects polyamine metabolism with central carbon metabolism

    • Influences energy homeostasis through effects on membrane potential

    • Interfaces with amino acid metabolism pathways (arginine, methionine)

    • Affects translation efficiency through polyamine-dependent mechanisms

What computational approaches are most effective for predicting MdtI structure and interactions?

Multiple computational approaches have proven valuable for predicting and analyzing MdtI structure and interactions:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.