Recombinant Salmonella paratyphi A Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

MdtJ functions as a spermidine export protein within the Salmonella paratyphi A multidrug efflux system. Key features include:

Gene and Protein Information

AttributeDetails
Gene NamemdtJ (synonyms: ydgF, SSPA1274)
Protein NameSpermidine export protein MdtJ
UniProt IDB5BK90
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cells
Purity≥85% (SDS-PAGE verified)

MdtJ facilitates spermidine export, a polyamine critical for neutralizing reactive oxygen species (ROS) during macrophage infection . This activity enhances bacterial survival under oxidative stress .

Immunological and Pathogenic Relevance

MdtJ contributes to Salmonella virulence by counteracting host immune defenses:

Key Findings

  • Antioxidant Role: Spermidine export via MdtJ reduces intracellular ROS in Salmonella, enabling survival within macrophages .

  • Phagocytosis Resistance: Mutants lacking spermidine transporters (ΔpotCD or ΔspeED) show impaired macrophage uptake and proliferation .

  • Vaccine Potential: Recombinant outer membrane proteins (e.g., rT2544 in S. Typhi) induce robust humoral and cellular immune responses , suggesting MdtJ could serve as a vaccine antigen.

Applications in Research and Development

Current Uses

  • Antibody Production: Recombinant MdtJ is used to generate species-specific monoclonal antibodies for diagnostic assays .

  • Drug Target Screening: Inhibitors targeting spermidine efflux could reduce bacterial stress tolerance .

Therapeutic Insights

  • The FDA-approved drug DFMO, which inhibits polyamine biosynthesis, reduces Salmonella colonization in mice , highlighting the translational relevance of MdtJ-related pathways.

Challenges and Future Directions

  • Stability Issues: Lyophilized MdtJ requires strict storage conditions (-80°C) to prevent degradation .

  • Functional Studies: Structural elucidation and in vivo efficacy trials are needed to validate its vaccine potential .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdtJ; SSPA1274; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
mdtJ
Target Protein Sequence
MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKGAARATI
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links

KEGG: sek:SSPA1274

Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MdtJ and what is its role in Salmonella paratyphi A?

MdtJ is a membrane protein that functions as part of the MdtJI complex, which catalyzes the excretion of spermidine from bacterial cells. It belongs to the small multidrug resistance (SMR) family of drug exporters. In Salmonella paratyphi A, this protein plays a crucial role in managing intracellular spermidine levels, which is essential for bacterial homeostasis and survival. The full-length protein consists of 120 amino acids and forms a functional complex with MdtI to effectively export spermidine from the cell .

Research has demonstrated that both mdtJ and mdtI are necessary for recovery from the toxicity associated with spermidine overaccumulation. This was shown through experiments where cells transformed with plasmids encoding both proteins (pUCmdtJI or pMWmdtJI) recovered from spermidine-induced toxicity, whereas cells lacking these proteins showed growth inhibition .

How does the MdtJI complex respond to spermidine levels in bacterial cells?

The MdtJI complex exhibits a regulatory mechanism in response to cellular spermidine levels. Studies have shown that mdtJI mRNA levels increase in the presence of elevated spermidine concentrations, indicating a transcriptional response to this polyamine. This upregulation allows the bacterial cell to enhance its spermidine export capacity when intracellular levels become potentially toxic .

Experimentally, this response was observed when bacterial cells cultured in media containing 2 mM spermidine showed decreased intracellular spermidine content when the MdtJI complex was present. The mechanism appears to be a feedback response that helps maintain polyamine homeostasis within the bacterial cell, preventing the accumulation of toxic levels while ensuring sufficient amounts for essential cellular functions .

What expression systems are most effective for producing recombinant MdtJ protein?

Several expression systems can be used to produce recombinant MdtJ protein, with E. coli being the most commonly utilized for initial characterization studies. Research data indicates successful expression of full-length Salmonella paratyphi A MdtJ in E. coli systems, particularly when fused to tags that aid in purification and solubility .

The choice of expression system depends on the specific experimental requirements:

Expression SystemAdvantagesDisadvantagesRecommended Applications
E. coliHigh yield, cost-effective, rapid expressionMay form inclusion bodies, limited post-translational modificationsInitial characterization, structural studies
YeastBetter folding for membrane proteins, some post-translational modificationsLower yield than E. coli, longer expression timeFunctional studies requiring proper folding
Mammalian cellsNative-like post-translational modificationsExpensive, time-consuming, lower yieldsInteraction studies, complex formation analysis
Insect cellsHigh expression of membrane proteins, proper foldingRelatively expensive, specialized equipment neededStructural studies, functional characterization

For MdtJ expression specifically, E. coli systems have proven effective, particularly when using strains like BL21(DE3) that are designed for membrane protein expression .

What purification strategies yield the highest purity and activity for recombinant MdtJ?

Purification of MdtJ typically employs affinity chromatography approaches, with immobilized metal affinity chromatography (IMAC) being particularly effective for His-tagged variants. A systematic purification protocol for obtaining high-purity, active MdtJ protein typically includes:

  • Membrane fraction isolation: Following cell lysis, differential centrifugation separates membrane fractions containing the expressed MdtJ protein.

  • Detergent solubilization: Membrane proteins require detergent solubilization, with detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) being effective for MdtJ.

  • Affinity chromatography: His-tagged MdtJ can be purified using Ni-NTA columns with imidazole elution gradients.

  • Size exclusion chromatography: A final polishing step using size exclusion chromatography helps remove aggregates and ensures a homogeneous protein preparation.

Purity levels exceeding 90% are achievable using this approach, as demonstrated in studies with recombinant MdtJ protein . For active protein, it's crucial to maintain the protein in appropriate detergent micelles throughout the purification process to preserve native structure and function.

How should recombinant MdtJ be stored to maintain stability and activity?

Recombinant MdtJ protein requires specific storage conditions to maintain stability and activity. Based on research protocols for membrane proteins and specific information for MdtJ:

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week in an appropriate buffer system.

  • Long-term storage: Lyophilization or storage at -20°C/-80°C in buffer containing cryoprotectants is recommended.

  • Buffer composition: Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been shown to be effective for maintaining MdtJ stability.

  • Cryoprotection: Addition of 5-50% glycerol (with 50% being optimal) helps prevent freeze-thaw damage.

  • Aliquoting: Division into single-use aliquots is strongly recommended to avoid repeated freeze-thaw cycles, which significantly reduce protein activity .

For reconstitution of lyophilized protein, deionized sterile water should be used to achieve a concentration of 0.1-1.0 mg/mL before addition of glycerol for long-term storage. Brief centrifugation before opening vials ensures maximum recovery of the protein .

What experimental methods can be used to assess MdtJ-mediated spermidine export activity?

Several experimental approaches can be employed to assess the spermidine export activity of MdtJ, with complementary methods providing robust validation:

  • Growth recovery assays: Using E. coli strains deficient in spermidine acetyltransferase (which normally metabolizes spermidine), researchers can measure growth recovery upon expression of MdtJ and MdtI in the presence of toxic spermidine concentrations. This approach provides a functional readout of spermidine export activity .

  • Radioactive spermidine uptake/export assays: Using [14C]-labeled or [3H]-labeled spermidine, researchers can directly measure spermidine export from cells expressing MdtJ/MdtI compared to control cells.

  • Measurement of intracellular spermidine levels: Using HPLC or LC-MS/MS analysis to quantify intracellular spermidine concentrations in cells expressing or lacking MdtJ. Studies have shown that cells expressing the MdtJI complex and cultured in the presence of 2 mM spermidine display reduced intracellular spermidine content compared to control cells .

  • Membrane vesicle transport assays: Inside-out membrane vesicles prepared from cells expressing MdtJI can be used to directly measure spermidine transport in a controlled system.

These methods provide complementary data on the transport activity and can be used to assess the impact of mutations in key residues like Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 that have been identified as important for MdtJ function .

How can the interaction between MdtJ and MdtI be studied and characterized?

The interaction between MdtJ and MdtI, which is essential for forming a functional spermidine export complex, can be studied using several biophysical and biochemical techniques:

  • Co-immunoprecipitation: Using antibodies against tagged versions of either MdtJ or MdtI to pull down the protein complex and identify interaction by Western blot.

  • Bacterial two-hybrid assays: Genetic systems that link protein-protein interactions to a measurable phenotype, useful for confirming interactions in a cellular context.

  • FRET (Förster Resonance Energy Transfer): Tagging MdtJ and MdtI with compatible fluorophores to measure energy transfer as an indication of close proximity and interaction.

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry analysis to identify interfaces between the two proteins.

  • Co-purification assays: Co-expression of both proteins with different tags, followed by tandem affinity purification to isolate the intact complex.

Research has demonstrated that both proteins are required for functional spermidine export, as cells transformed with plasmids encoding both MdtJ and MdtI (pUCmdtJI or pMWmdtJI) recovered from spermidine toxicity, indicating that they form a functional complex in vivo .

What methods can determine the key amino acid residues involved in MdtJ function?

Site-directed mutagenesis studies have identified several key amino acid residues in MdtJ that are critical for its function in spermidine export. These include Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 . The methods used to identify and characterize these residues include:

  • Alanine-scanning mutagenesis: Systematic replacement of residues with alanine to identify those essential for function.

  • Conservative and non-conservative substitutions: Replacing key residues with amino acids of similar or different properties to understand the biochemical requirements at each position.

  • Functional complementation assays: Testing whether mutated versions of MdtJ can restore spermidine resistance in strains deficient in spermidine export.

  • Structural modeling and molecular dynamics: Computational approaches to predict the role of specific residues in substrate binding or transport.

Results from these experiments indicate that the identified residues likely form part of the substrate binding pocket or channel through which spermidine is transported. The charged residues (Glu15, Glu82) may interact with the positively charged amine groups of spermidine, while the aromatic residues (Tyr4, Trp5, Tyr45, Tyr61) may form hydrophobic interactions with the carbon backbone of spermidine .

How can metabolomic approaches be integrated with MdtJ research to understand Salmonella pathogenesis?

Metabolomic approaches offer powerful tools for understanding the role of MdtJ in Salmonella pathogenesis by revealing how polyamine transport affects bacterial metabolism and host-pathogen interactions. A comprehensive research strategy might include:

Research has demonstrated that metabolomic approaches can identify reproducible and serovar-specific systemic biomarkers during enteric fever. Similar strategies could reveal how MdtJ function contributes to these metabolic signatures and potentially identify new diagnostic markers or therapeutic targets .

What approaches can be used to develop inhibitors of MdtJ as potential antimicrobial agents?

Developing inhibitors of MdtJ as potential antimicrobial agents requires a multi-faceted approach:

  • Structure-based drug design: Using computational modeling based on the amino acid sequence and predicted structure of MdtJ to design molecules that bind to and inhibit the protein. This approach is particularly powerful if crystal structures or reliable homology models are available.

  • High-throughput screening: Testing libraries of compounds for their ability to inhibit MdtJ-mediated spermidine export in bacterial cells or membrane vesicles.

  • Fragment-based drug discovery: Identifying small molecular fragments that bind to MdtJ and then optimizing these into more potent inhibitors.

  • Peptidomimetic approaches: Designing peptides or peptidomimetics that interfere with the MdtJ-MdtI interaction, preventing formation of a functional complex.

  • Natural product screening: Testing extracts from various sources for inhibitory activity against MdtJ function.

For all these approaches, functional assays measuring spermidine export (as described in section 3.1) would be essential for validating potential inhibitors. Additionally, counter-screening against mammalian polyamine transporters would be important to ensure selectivity for the bacterial target .

How can advanced imaging techniques be applied to study MdtJ localization and dynamics in bacterial cells?

Advanced imaging techniques provide valuable insights into the localization, dynamics, and interactions of MdtJ in bacterial cells:

  • Super-resolution microscopy: Techniques like STORM (Stochastic Optical Reconstruction Microscopy) or PALM (Photoactivated Localization Microscopy) can visualize MdtJ distribution in the bacterial membrane with resolution below the diffraction limit (approximately 20-30 nm).

  • Single-particle tracking: Using fluorescently labeled MdtJ to track individual molecules in living bacterial cells, revealing dynamics and potential clustering behavior.

  • FRAP (Fluorescence Recovery After Photobleaching): Measuring the mobility of MdtJ in the membrane by photobleaching a region and monitoring fluorescence recovery.

  • Correlative light and electron microscopy (CLEM): Combining fluorescence microscopy to locate MdtJ with electron microscopy to visualize ultrastructural context.

  • Expansion microscopy: Physical expansion of bacterial cells to achieve super-resolution imaging on standard microscopes.

For these techniques, MdtJ can be tagged with fluorescent proteins (e.g., GFP, mCherry) or small epitope tags for immunofluorescence. Research has shown that proper folding and membrane insertion of MdtJ is critical for its function, so validation that imaging constructs retain activity is essential .

What strategies can overcome challenges in expressing and purifying functional MdtJ protein?

Membrane proteins like MdtJ present several challenges during expression and purification. Research-backed strategies to overcome these include:

  • Optimizing expression conditions:

    • Reducing expression temperature (16-25°C) to slow protein production and improve folding

    • Using specialized E. coli strains (C41, C43, Rosetta-GAMI) designed for membrane protein expression

    • Testing induction conditions (IPTG concentration, induction time) to find optimal parameters

  • Fusion tags and partners:

    • N-terminal fusion with MBP (maltose-binding protein) or SUMO to improve solubility

    • C-terminal fusions may be less disruptive to membrane insertion

    • GFP fusions allow monitoring of expression and folding in real-time

  • Detergent screening:

    • Systematic testing of different detergents (DDM, LMNG, OG, CHAPS) for solubilization

    • Detergent mixtures sometimes perform better than single detergents

    • Lipid addition during solubilization can stabilize the protein

  • Stabilization strategies:

    • Addition of spermidine during purification can stabilize the protein in its substrate-bound form

    • Testing different pH conditions and buffer compositions

    • Addition of glycerol or specific lipids to mimic the native membrane environment

How can researchers differentiate between effects of MdtJ alone versus the MdtJI complex in experimental systems?

Distinguishing between the effects of MdtJ alone versus the MdtJI complex requires careful experimental design:

  • Expression constructs:

    • Create separate constructs expressing MdtJ only, MdtI only, and both proteins together

    • Use different or compatible tags to enable selective purification or detection

    • Create a fusion protein linking MdtJ and MdtI to ensure stoichiometric expression

  • Complementation experiments:

    • Test each construct (MdtJ, MdtI, MdtJI) for ability to rescue spermidine toxicity in appropriate strains

    • Research has shown that both proteins are required for function, as evidenced by recovery from spermidine toxicity only when both proteins are expressed

  • Biochemical characterization:

    • Compare protein stability, folding, and membrane integration of MdtJ alone versus in complex with MdtI

    • Assess spermidine binding capability of individual proteins versus the complex

  • Structural studies:

    • Crystallography or cryo-EM of individual proteins versus the complex

    • Crosslinking studies to identify interaction interfaces

  • In vivo localization:

    • Fluorescent tagging to visualize localization of MdtJ with and without MdtI co-expression

Research has established that both proteins are necessary for spermidine export function, indicating that they form an obligate functional complex in vivo .

What controls and validation steps are essential when studying MdtJ-mediated spermidine transport?

Rigorous controls and validation steps are critical for reliable results when studying MdtJ-mediated spermidine transport:

  • Negative controls:

    • Empty vector controls in expression systems

    • Inactive mutants of MdtJ (e.g., mutations in key residues like Tyr4, Trp5, Glu15)

    • Experiments in the absence of spermidine to establish baseline transport

  • Positive controls:

    • Known spermidine transporters from other systems

    • Wild-type MdtJI complex with established activity

    • Spermidine analogues with known transport profiles

  • Validation of protein expression and localization:

    • Western blot confirmation of protein expression

    • Membrane fraction analysis to confirm proper localization

    • Fluorescence microscopy to visualize membrane localization

  • Functional validation:

    • Multiple independent methods to measure spermidine transport (e.g., radioactive transport assays, growth assays, intracellular concentration measurements)

    • Dose-response experiments with varying spermidine concentrations

    • Competition experiments with other polyamines or inhibitors

  • Specificity controls:

    • Testing transport of related polyamines (putrescine, cadaverine, spermine)

    • Examining effects on transport of other compounds to confirm specificity

Research has established that the MdtJI complex specifically transports spermidine, and that certain amino acid residues in both proteins are critical for this function. Any experimental system should include controls to validate these established properties .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.