Recombinant Salmonella paratyphi A Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
arnC; SSPA0529; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
arnC
Target Protein Sequence
MFDAAPIKKVSVVIPVYNEQESLPELIRRTTAACESLGKAWEILLIDDGSSDSSAELMVK ASQEADSHIISILLNRNYGQHAAIMAGFSHVSGDLIITLDADLQNPPEEIPRLVAKADEG FDVVGTVRQNRQDSLFRKSASKIINLLIQRTTGKAMGDYGCMLRAYRRPIIDTMLRCHER STFIPILANIFARRATEIPVHHAEREFGDSKYSFMRLINLMYDLVTCLTTTPLRLLSLLG SVIAIGGFSLSVLLIVLRLALGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYN DVRARPRYFVQQVIYPESTSFTEESHQ
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxin and cationic antimicrobial peptides.

Database Links

KEGG: sek:SSPA0529

Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Salmonella paratyphi A ArnC?

Salmonella paratyphi A ArnC is a glycosyltransferase with three distinct regions: an N-terminal glycosyltransferase domain, a transmembrane region, and interface helices (IHs). Recent cryo-EM studies of the homologous protein in Salmonella typhimurium revealed that ArnC forms a stable tetramer with C2 symmetry through interactions in the C-terminal region, which protrudes into the cytosol with the β8 strand inserting into the adjacent protomer . The protomers establish two distinct types of interfaces involving multiple hydrogen bonds and salt bridges. When UDP binds to ArnC, it induces conformational changes that stabilize the structurally labile A-loop (spanning residues 201 to 213) and part of the putative catalytic pocket formed by IH1 and IH2 .

What is the primary function of ArnC in antimicrobial resistance?

ArnC is a critical enzyme in the antimicrobial resistance mechanism employed by Gram-negative bacteria against polymyxins, which are last-resort antimicrobial peptides used against multi-drug resistant pathogens. ArnC functions within a defense relay of enzymes encoded by the pmrE(ugd) loci and the arnBCDTEF operon . This enzymatic pathway adds an Ara-4N (4-amino-4-deoxy-L-arabinose) headgroup to the lipid-A component of outer membrane lipopolysaccharides (LPS), rendering polymyxins ineffective . Understanding this mechanism is crucial for developing strategies to combat antimicrobial resistance in Salmonella paratyphi A and related pathogens.

How does ArnC interact with undecaprenyl phosphate in the bacterial cell membrane?

ArnC interacts with undecaprenyl phosphate (Und-P), an essential lipid carrier that ferries cell wall intermediates across the cytoplasmic membrane in bacteria . As a glycosyltransferase, ArnC catalyzes the transfer of the 4-deoxy-4-formamido-L-arabinose moiety to Und-P. The resulting modified lipid carrier plays a crucial role in modifying lipopolysaccharides, particularly lipid A, with the Ara-4N group. This modification alters the bacterial outer membrane charge, reducing the binding affinity of cationic antimicrobial peptides like polymyxins . The interaction involves the transmembrane region of ArnC, which positions the enzyme appropriately to access both the lipid substrate and the cytoplasmic catalytic domain.

What are the optimal expression systems for producing recombinant Salmonella paratyphi A ArnC?

The optimal expression systems for producing recombinant Salmonella paratyphi A ArnC should account for the protein's membrane-associated nature and complex quaternary structure. Based on successful approaches with related proteins:

For optimal expression, consider:

  • Using a fusion tag (His6, MBP, or GST) to facilitate purification and potentially improve solubility

  • Employing low induction temperatures (16-20°C) to promote proper folding

  • Including appropriate detergents (DDM, LMNG) during extraction and purification to maintain the native structure of the membrane-associated regions

  • Supplementing with UDP during purification to stabilize the protein structure

What are the most effective methods for analyzing ArnC enzymatic activity?

Analyzing ArnC enzymatic activity requires specialized approaches due to its membrane association and lipid substrate. The most effective methods include:

  • Radioisotope-Based Assays:

    • Using [14C]-labeled UDP-4-amino-4-deoxy-L-arabinose as substrate

    • Measuring transfer to undecaprenyl phosphate

    • Quantifying product formation by scintillation counting after extraction

  • Mass Spectrometry-Based Approaches:

    • LC-MS/MS to detect and quantify reaction products

    • Allows for detailed structural characterization of modified lipids

    • Can monitor multiple reaction intermediates simultaneously

  • Fluorescence-Based Assays:

    • Using fluorescently labeled substrate analogs

    • Real-time monitoring of enzymatic activity

    • High-throughput screening applications

  • In Vivo Complementation Assays:

    • Expressing recombinant ArnC in arnC-deficient strains

    • Measuring restoration of polymyxin resistance

    • Evaluating functional activity in the cellular context

When conducting activity assays, critical controls should include heat-inactivated enzyme, reactions without undecaprenyl phosphate, and reactions with known inhibitors of glycosyltransferases. Additionally, optimizing reaction conditions (pH 7.5-8.0, 1-5 mM Mg2+ or Mn2+) is essential for reliable measurements of enzymatic activity.

How can cryo-EM techniques be effectively applied to study the structure of Salmonella paratyphi A ArnC?

Cryo-EM has proven highly effective for studying the structure of membrane-associated proteins like ArnC. Based on recent successful studies of the homologous S. typhimurium ArnC , the following approach is recommended:

  • Sample Preparation:

    • Purify ArnC in appropriate detergents (LMNG or DDM)

    • Consider reconstitution in nanodiscs for a more native-like environment

    • Prepare both apo-protein and ligand-bound states (with UDP)

    • Optimize protein concentration (1.5-3 mg/mL) for grid preparation

  • Data Collection Parameters:

    • Use 300 kV transmission electron microscope

    • Employ energy filters and K3 direct electron detectors

    • Collect at nominal magnification providing 0.8-1.1 Å/pixel

    • Use dose-fractionation (40-50 total frames) with low dose per frame

  • Data Processing Strategy:

    • Perform motion correction and CTF estimation

    • Use reference-free 2D classification to select homogeneous particles

    • Apply 3D classification to separate different conformational states

    • Implement C2 symmetry during refinement, based on the tetrameric structure

    • Conduct focused refinement on regions of interest, particularly the catalytic domain

  • Structural Analysis Approaches:

    • Compare apo and UDP-bound structures to identify conformational changes

    • Analyze the A-loop region (residues 201-213) and catalytic pocket formed by IH1 and IH2

    • Perform comparative analysis with homologs like GtrB and DPMS to identify key catalytic residues

This approach has yielded high-resolution structures (2.75 Å for apo and 3.8 Å for UDP-bound forms) for S. typhimurium ArnC and should be applicable to S. paratyphi A ArnC.

How does genomic diversity of Salmonella paratyphi A impact arnC expression and function?

Genomic diversity of Salmonella paratyphi A significantly influences arnC expression and function across different strains and geographical regions. Recent whole genome sequencing studies of S. paratyphi A isolates from endemic regions like Nepal have revealed several key insights:

  • Genotype Distribution and Replacement: Certain genotypes, such as 2.4.3, have shown clonal expansion and systematic replacement of other genotypes over time . This clonal expansion was hypothesized to be driven by both reduced susceptibility to fluoroquinolones and genetic changes to virulence factors, including functional and structural genes encoding type 3 secretion systems . These population-level changes may impact arnC expression patterns and antimicrobial resistance profiles.

  • Geographical Variation: Substantial genomic diversity exists among S. paratyphi A isolates from different South Asian countries, which collectively account for >80% of all paratyphoid cases globally . This genomic diversity may translate to variations in arnC sequence, expression, and function across different regions.

  • Transmission Patterns: Genomic studies suggest that person-to-person transmission is likely the most common mode of S. paratyphi A spread, with chronic carriers playing a limited role in maintaining disease circulation . This transmission pattern influences how arnC-mediated antimicrobial resistance genes spread through populations.

  • Adaptations to Environmental Pressures: Changes in antimicrobial usage patterns create selective pressures that drive genomic adaptations, potentially affecting arnC expression. For example, the prevalence of fluoroquinolone resistance markers increased significantly in certain populations over time .

For researchers studying arnC, characterizing the specific genotype of their S. paratyphi A strain is essential for contextualizing findings within the broader genomic landscape and understanding potential variations in arnC expression and function across strains.

What approaches are recommended for detecting polymorphisms in the arnC gene across Salmonella paratyphi A isolates?

For comprehensive detection of polymorphisms in the arnC gene across Salmonella paratyphi A isolates, researchers should employ a multi-faceted approach:

  • Whole Genome Sequencing (WGS):

    • Use high-throughput sequencing platforms (Illumina, Oxford Nanopore)

    • Aim for >30x coverage for reliable variant calling

    • Apply the Paratype genotyping framework, an open-access SNP-based scheme developed specifically for S. paratyphi A, to systematically categorize genomes

  • Targeted Amplicon Sequencing:

    • Design primers flanking the arnC gene and regulatory regions

    • Use long-read technologies for complete gene coverage

    • Pool samples with unique barcodes for cost-effective screening of large isolate collections

  • Comparative Genomic Analysis:

    • Align arnC sequences from diverse geographical isolates

    • Identify single nucleotide polymorphisms (SNPs) and structural variations

    • Correlate polymorphisms with antimicrobial resistance phenotypes

    • Use visualization tools to map variations to protein structure

  • Functional Validation of Variants:

    • Express recombinant protein variants with identified polymorphisms

    • Compare enzymatic activity and thermostability of variants

    • Assess impact on antimicrobial resistance in vivo

A recent study examining 216 S. paratyphi A isolates from Nepal collected between 2005-2014 demonstrated the value of this approach by identifying key mutations associated with antimicrobial resistance and virulence . When analyzing arnC specifically, researchers should pay particular attention to mutations in the catalytic domain and regions involved in tetramer formation, as these may significantly impact function and stability.

How do environmental factors influence the expression and activity of arnC in Salmonella paratyphi A populations?

Environmental factors significantly modulate the expression and activity of arnC in Salmonella paratyphi A populations, creating a complex interplay between bacterial adaptation and pathogenicity:

  • Antimicrobial Pressure:

    • The presence of polymyxins and other cationic antimicrobial peptides induces the PmrAB two-component regulatory system, which upregulates the arnBCDTEF operon

    • Subinhibitory concentrations of antimicrobials in clinical and environmental settings can drive selection for constitutive arnC expression

    • Historical usage patterns of antimicrobials correlate with fluctuations in arnC expression levels across different geographical regions

  • Environmental Cations:

    • High concentrations of Fe3+, Al3+, and low Mg2+ activate PmrAB, leading to increased arnC expression

    • Water sources with specific mineral compositions may influence the baseline expression of arnC in endemic regions

    • This may partially explain observations from Nepal where municipal water sources were associated with higher rates of S. paratyphi A infections regardless of water treatment methods

  • Seasonal Variations:

    • S. paratyphi A isolation rates peak during summer months in endemic regions like Nepal

    • Increased rainfall and flooding during these periods may promote water contamination, altering bacterial exposure to environmental stressors

    • Warmer temperatures may affect bacterial metabolism and gene expression patterns, including arnC

  • Host Microenvironment:

    • The conditions within the human host, particularly acidic pH and antimicrobial peptides, influence arnC expression

    • Chronic carriers show different arnC expression patterns compared to acute infections

    • The gallbladder environment of chronic carriers creates unique selective pressures

Understanding these environmental influences is crucial for researchers studying S. paratyphi A arnC, as laboratory conditions may not fully recapitulate the complex environmental factors driving gene expression and protein function in natural settings. When designing experiments, researchers should consider incorporating relevant environmental conditions to better model in vivo arnC activity.

How can augmented experimental designs be applied to optimize research on ArnC function?

Augmented experimental designs offer valuable approaches for optimizing research on ArnC function, particularly when dealing with limited resources or numerous experimental conditions. Based on principles of experimental design , the following strategies are recommended:

  • Partial Replication Designs:

    • Fully replicate a subset of critical treatments (e.g., wild-type ArnC, key catalytic mutants)

    • Include unreplicated treatments for exploratory conditions (e.g., various point mutations, environmental conditions)

    • This reduces costs with an acceptable loss of precision while allowing broader exploration of factors affecting ArnC function

  • Augmented Block Designs:

    • Organize experiments into blocks containing both replicated standard treatments and unreplicated test treatments

    • Example application: Testing multiple ArnC variants across different pH conditions

    • This approach controls for batch effects while maximizing the number of conditions tested

  • Response Surface Methodology:

    • Systematically vary multiple factors (substrate concentration, pH, temperature, ion concentration)

    • Focus replication around predicted optimal conditions

    • This approach is particularly valuable for optimizing ArnC enzymatic assays

  • Sequential Experimental Design:

    • Begin with broad screening using unreplicated designs

    • Follow with focused, fully replicated experiments on promising conditions

    • This adaptive approach maximizes information gain while minimizing resource use

When implementing these designs, researchers should consider the following recommendations :

Design TypeKey AdvantagesStatistical Analysis ApproachAppropriate Applications
Control-AugmentedCompares test treatments to controlsANOVA with control comparisonsInitial screening of ArnC variants
Check-AugmentedDistributes standard treatments throughout designMixed model with spatial correlationAssay optimization across multiple conditions
Systematically AugmentedStructured addition of treatments to standard designLinear models with defined contrastsTesting multiple environmental factors

These designs are particularly valuable when screening numerous ArnC point mutations, optimizing expression conditions, or exploring combinations of environmental factors affecting enzyme activity.

What approaches can be used to identify and resolve contradictions in experimental data regarding ArnC structure and function?

Resolving contradictions in experimental data regarding ArnC structure and function requires systematic approaches to identify, analyze, and address discrepancies. The following methodology is recommended:

  • Structured Contradiction Detection:

    • Implement a FACTTRACK-like approach to systematically identify contradictions in experimental findings

    • Decompose complex findings into "atomic facts" about ArnC structure/function

    • Establish validity intervals for each fact (conditions under which the fact holds true)

    • Use this framework to detect contradictions when facts overlap in their validity domains

  • Cross-Methodology Validation:

    • Triangulate findings using multiple experimental approaches:

      • Combine structural methods (X-ray crystallography, cryo-EM, NMR)

      • Correlate in vitro enzymatic assays with in vivo functional studies

      • Use computational predictions to bridge gaps between experimental findings

    • Develop a confidence score for each finding based on methodological strength and replication

  • Contextual Analysis of Contradictions:

    • Examine experimental conditions systematically when contradictions emerge:

      • Differences in protein constructs (full-length vs. truncated)

      • Expression systems and purification protocols

      • Buffer compositions and reaction conditions

      • Substrate sources and purity

  • Bayesian Integration Framework:

    • Assign prior probabilities to competing hypotheses about ArnC

    • Update beliefs based on strength of evidence from each experiment

    • Calculate posterior probabilities to identify most likely explanations

    • This approach is particularly useful when contradictory results exist in the literature

A practical example of contradiction resolution comes from studying ArnC's oligomeric state. If different studies report monomeric, dimeric, and tetrameric forms, the contradiction can be resolved by:

  • Determining if differences stem from detergent choice during purification

  • Examining if concentration-dependent oligomerization occurs

  • Assessing if the presence of substrates/cofactors affects oligomerization

  • Comparing full-length protein behavior with truncated constructs

By systematically analyzing the conditions under which each observation was made, researchers can often identify the specific factors driving apparent contradictions and develop a unified model of ArnC structure and function.

How can advanced computational methods enhance our understanding of ArnC catalytic mechanisms?

Advanced computational methods offer powerful approaches to elucidate ArnC catalytic mechanisms at atomic resolution. Researchers should consider implementing the following computational strategies:

  • Molecular Dynamics (MD) Simulations:

    • Perform all-atom MD simulations of ArnC in explicit membrane environments

    • Conduct long-timescale (μs-ms) simulations to capture conformational changes during catalysis

    • Implement enhanced sampling techniques (metadynamics, umbrella sampling) to explore free energy landscapes

    • Analyze simulations to identify:

      • Conformational changes upon UDP binding

      • Stabilization of the A-loop (residues 201-213)

      • Dynamics of the catalytic pocket formed by IH1 and IH2

      • Water networks and proton transfer pathways

  • Quantum Mechanics/Molecular Mechanics (QM/MM):

    • Model the reaction mechanism with combined QM/MM approaches

    • Treat the active site at QM level (DFT methods) while representing the rest of the protein with MM

    • Calculate activation barriers for proposed catalytic mechanisms

    • Compare computational results with experimental kinetic data

  • Homology-Based Predictions and Evolutionary Analysis:

    • Leverage structural similarities with homologs like GtrB and DPMS

    • Perform evolutionary trace analysis to identify conserved residues

    • Conduct co-evolution analysis to identify functionally coupled residues

    • Use multiple sequence alignments to predict the impact of natural variants

  • Machine Learning and Network Analysis:

    • Train ML models on existing glycosyltransferase data to predict substrate specificity

    • Apply graph neural networks to analyze allosteric communication pathways

    • Implement protein language models to predict the impact of mutations on ArnC function

    • Use active learning to design optimal experiments for mechanism validation

These computational approaches should be integrated into a cohesive workflow that iterates between computational predictions and experimental validation. For example, MD simulations might identify a potentially important residue in the catalytic mechanism, guiding site-directed mutagenesis experiments. The results from these experiments would then refine the computational models in a virtuous cycle of hypothesis generation and testing.

What strategies can be employed to design specific inhibitors targeting ArnC from Salmonella paratyphi A?

Designing specific inhibitors targeting ArnC from Salmonella paratyphi A requires a multi-faceted approach leveraging structural information, computational methods, and high-throughput screening. Based on current understanding of ArnC structure and function , the following strategies are recommended:

  • Structure-Based Drug Design:

    • Target the UDP-binding site, leveraging the conformational changes observed in the A-loop (residues 201-213) upon UDP binding

    • Focus on the catalytic pocket formed by interface helices IH1 and IH2

    • Design compounds that disrupt the tetramer formation, targeting the C-terminal interactions where the β8 strand inserts into adjacent protomers

    • Develop transition-state analogs based on the glycosyl transfer reaction mechanism

  • Fragment-Based Approaches:

    • Screen fragment libraries against purified ArnC using thermal shift assays and STD-NMR

    • Identify binding hotspots in both the active site and allosteric regions

    • Link or grow fragments to develop lead compounds with improved potency and specificity

    • Target protein-protein interaction interfaces in the tetrameric structure

  • Computational Screening and Design:

    • Perform virtual screening of compound libraries against multiple conformational states

    • Use molecular dynamics simulations to identify transient pockets not visible in static structures

    • Design peptidomimetics targeting the interface between protomers

    • Implement machine learning models trained on glycosyltransferase inhibitors to predict new scaffolds

  • Natural Product Exploration:

    • Screen natural product libraries for inhibitory activity

    • Focus on compounds with structural similarity to UDP or undecaprenyl phosphate

    • Investigate compounds from bacteria that naturally compete with Salmonella in environmental niches

A rational inhibitor design workflow should incorporate these strategic elements while ensuring specificity against human glycosyltransferases. Candidate inhibitors should be evaluated not only for their binding affinity to ArnC but also for their ability to restore polymyxin sensitivity in resistant strains. The most promising compounds can then be further optimized for pharmacokinetic properties and in vivo efficacy.

How can researchers address the challenges of studying membrane-associated proteins like ArnC in reconstructed systems?

Studying membrane-associated proteins like ArnC in reconstructed systems presents unique challenges that require specialized approaches. Based on recent advances in membrane protein biochemistry, the following strategies are recommended:

  • Membrane Mimetic Selection:

    • Compare multiple membrane mimetic systems for optimal ArnC reconstitution:

Membrane MimeticAdvantagesLimitationsBest Applications
Detergent micellesSimple preparation, good for initial studiesMay destabilize quaternary structureInitial purification, basic activity assays
Nanodiscs (MSP or SMALP)Native-like bilayer, defined sizeComplex assembly, limited lipid dynamicsStructural studies, single-molecule assays
LiposomesFully enclosed bilayer, gradient formationHeterogeneous, difficult for direct structureTransport assays, functional reconstitution
Lipid cubic phasesSupport crystal formationLimited to certain techniquesX-ray crystallography
Supported lipid bilayersPlanar geometry, surface techniquesOne side exposed to solid supportSurface-sensitive techniques (AFM, SPR)
  • Lipid Composition Optimization:

    • Systematically vary lipid composition to match native bacterial membrane

    • Include physiologically relevant lipids like phosphatidylethanolamine and cardiolipin

    • Test the effect of lipid headgroup charge on ArnC activity and stability

    • Consider incorporating native LPS components to better mimic the native environment

  • Co-reconstitution Approaches:

    • Reconstitute ArnC with functional partners from the arnBCDTEF operon

    • Create minimal systems that recapitulate the complete Ara4N addition pathway

    • Study protein-protein interactions within the membrane environment

    • Investigate substrate channeling between pathway components

  • Advanced Biophysical Techniques:

    • Implement hydrogen-deuterium exchange mass spectrometry to probe membrane-protein interfaces

    • Use site-specific fluorescence labeling to monitor conformational changes

    • Apply solid-state NMR to study protein dynamics in membrane environments

    • Develop in vitro assays that incorporate native substrates like undecaprenyl phosphate

When working with reconstructed systems, researchers should validate that ArnC maintains its native tetrameric structure and enzymatic activity. Comparing multiple reconstitution approaches in parallel can provide complementary insights and help distinguish protein properties from artifacts of specific membrane mimetics.

What are the most promising future research directions for understanding the role of ArnC in bacterial antimicrobial resistance?

The study of ArnC in bacterial antimicrobial resistance offers several promising research directions that could significantly advance our understanding and lead to new therapeutic strategies:

  • Systems Biology of Resistance Pathways:

    • Map the regulatory networks controlling arnC expression across different environmental conditions

    • Develop quantitative models of the entire Ara4N modification pathway

    • Investigate interactions between the arn operon and other resistance mechanisms

    • Create predictive models of resistance emergence in response to antimicrobial pressure

  • Evolutionary Dynamics and Horizontal Gene Transfer:

    • Track the spread of arnC variants across bacterial populations and species

    • Investigate the role of mobile genetic elements in disseminating the arn operon

    • Apply Paratype and similar genotyping frameworks to monitor antimicrobial resistance dissemination

    • Explore how arnC sequence diversity correlates with resistance phenotypes across geographical regions

  • Novel Therapeutic Approaches:

    • Design adjuvants that target ArnC to restore polymyxin sensitivity

    • Explore combination therapies that simultaneously target multiple resistance mechanisms

    • Develop CRISPR-based antimicrobials targeting the arn operon

    • Create phage-based delivery systems for ArnC inhibitors

  • Structural Dynamics and Conformational Landscapes:

    • Apply cryo-electron tomography to visualize ArnC in its native membrane environment

    • Use time-resolved structural techniques to capture catalytic intermediates

    • Investigate the impact of membrane composition on ArnC conformation and activity

    • Explore how ArnC interacts with other components of the Ara4N modification pathway

  • Translational Applications:

    • Develop diagnostics to rapidly detect active ArnC-mediated resistance

    • Create biosensors that monitor ArnC activity in clinical samples

    • Implement surveillance systems tracking ArnC variants in hospital environments

    • Explore vaccine approaches targeting exposed regions of the ArnC protein

These research directions would benefit from interdisciplinary collaboration between structural biologists, microbiologists, evolutionary biologists, and computational scientists. Combining genomic surveillance approaches with detailed structural and functional studies will provide a comprehensive understanding of ArnC's role in antimicrobial resistance and guide the development of new strategies to combat resistant infections.

What are the key considerations for researchers planning comprehensive studies on Salmonella paratyphi A ArnC?

Researchers planning comprehensive studies on Salmonella paratyphi A ArnC should consider several key factors to ensure successful and impactful investigations. Based on current literature and methodological approaches, the following considerations are paramount:

  • Strain Selection and Genomic Context:

    • Select S. paratyphi A strains with well-characterized genomic backgrounds

    • Consider using strains from different genotypes identified through Paratype classification

    • Include clinical isolates from endemic regions showing varying levels of antimicrobial resistance

    • Sequence the complete arn operon to identify any strain-specific variations that might impact ArnC function

  • Experimental Design Optimization:

    • Implement augmented experimental designs when screening multiple conditions

    • Establish robust controls and replication strategies to ensure statistical power

    • Design experiments that distinguish between effects on expression, activity, and resistance phenotypes

    • Consider time-series experiments to capture dynamic responses to environmental changes

  • Methodological Integration:

    • Combine structural approaches (cryo-EM, X-ray crystallography) with functional assays

    • Validate in vitro findings with in vivo infection models or clinical correlations

    • Implement systems for detecting and resolving data contradictions

    • Develop computational models that integrate structural and functional data

  • Translational Relevance:

    • Align research questions with clinical challenges in managing enteric fever

    • Consider epidemiological patterns and regional variations in S. paratyphi A prevalence

    • Develop pipelines to translate basic findings into diagnostic or therapeutic applications

    • Establish collaborations with researchers in endemic regions for access to relevant clinical isolates

By addressing these considerations in the planning stages, researchers can develop comprehensive studies that not only advance fundamental understanding of ArnC structure and function but also contribute to addressing the significant public health challenges posed by antimicrobial-resistant Salmonella paratyphi A infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.