Recombinant Salmonella paratyphi A Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

uspB belongs to the universal stress protein (USP) family, which plays a role in bacterial survival under stress conditions such as nutrient deprivation, oxidative stress, or antibiotic exposure . In Salmonella Paratyphi A, it is encoded by the uspB gene (UniProt ID: B5BHN6) and spans 111 amino acids (1-111 aa). Recombinant uspB is typically expressed in E. coli with an N-terminal His-tag for purification .

PropertyDetailSource
Gene IDuspB (Synonyms: SSPA3219)
Protein LengthFull-length (1-111 aa)
TagN-terminal His-tag (10xHis)
Expression SystemE. coli (strain AKU_12601 or RKS4594)
Purity>90% (SDS-PAGE verified)
Storage ConditionsLyophilized powder stored at -20°C/-80°C; avoid freeze-thaw cycles

Role in Stress Adaptation

USPs like uspB are upregulated under stress conditions, enabling bacteria to manage oxidative damage, nutrient scarcity, or osmotic changes . For Salmonella, these proteins may enhance survival in host niches, such as the gastrointestinal tract or intracellular environments.

Vaccine Development

Recombinant uspB is used in research to study antigenic epitopes for vaccine design. While not directly tested in clinical trials, its homologs in other pathogens (e.g., E. coli) have been explored as vaccine candidates due to their conserved stress-related functions .

Diagnostic and Therapeutic Targets

uspB’s immunogenicity could be leveraged for serological assays or targeted therapies. For example, antisera against outer membrane proteins of Salmonella have shown bactericidal activity in preclinical models , suggesting similar potential for uspB.

Challenges and Future Directions

Despite its potential, several gaps remain:

  • Functional Characterization: Specific biochemical or immunological roles of uspB in Salmonella pathogenesis remain unexplored.

  • Clinical Relevance: No direct evidence links uspB to antibiotic resistance or virulence in Salmonella Paratyphi A.

Future studies should prioritize:

  1. Stress Response Profiling: Investigate uspB expression under simulated host environments.

  2. Vaccine Efficacy: Assess immunogenicity in animal models.

  3. Genomic Surveillance: Integrate uspB into tools like Paratype for tracking Salmonella evolution .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
uspB; SSPA3219; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
uspB
Target Protein Sequence
MISTVSLFWALCVVCIVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTTHGQPNKQV RLVWYIYAQRYRDHHDEEFIRRCERVRRQFLLTSALCGLVVVSLIALMIWH
Uniprot No.

Target Background

Database Links

KEGG: sek:SSPA3219

Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Universal stress protein B (uspB) from Salmonella paratyphi A?

Universal stress protein B (uspB) is a small cytoplasmic protein belonging to the PF00582 superfamily (COG0589) that plays a role in bacterial stress response mechanisms. In Salmonella paratyphi A, uspB (gene SSPA3219) encodes a 111-amino acid protein that helps the bacterium adapt to various environmental stressors. The protein is part of the broader universal stress protein family involved in resilience to adverse conditions encountered during host infection and environmental persistence .

How does uspB differ from other universal stress proteins in Salmonella species?

Universal stress proteins in Salmonella can be categorized into different subfamilies:

ProteinSize (aa)Main FunctionStress ResponseUnique Features
uspB111General stress responseMultiple stressorsMembrane association
uspA144DNA damage protectionOxidative, metabolicRequired for resistance to DNA-damaging agents
uspF/YnaF168ATP-binding activityOxidative stressα/β protein with conserved ATP-binding site

Unlike uspA, which is primarily involved in protection against DNA damage and oxidative stress, uspB appears to have broader responses to various environmental stressors. The uspF protein (also known as YnaF in some Salmonella species) shares functional similarities with uspB but contains a confirmed ATP-binding site that influences its stress response mechanisms .

What are the optimal conditions for recombinant expression of Salmonella paratyphi A uspB?

The recombinant expression of Salmonella paratyphi A uspB is typically performed in E. coli expression systems. The following methodology has been experimentally validated:

  • Expression System: E. coli BL21(DE3) pLysS or similar strains are recommended for high-yield expression

  • Vector Selection: pET-based vectors with N-terminal His-tag provide efficient purification options

  • Induction Parameters:

    • IPTG concentration: 0.5-1.0 mM

    • Temperature: Optimal expression at 30°C (reduced inclusion body formation compared to 37°C)

    • Duration: 4-6 hours post-induction

  • Media Components: LB medium supplemented with appropriate antibiotics based on expression vector resistance markers

The protein is usually expressed as a cytosolic protein and can yield approximately 100-150 mg/L of culture when optimized conditions are employed .

What purification strategy yields the highest purity and activity for recombinant uspB?

A multi-step purification approach is recommended to achieve >90% purity while maintaining biological activity:

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Bind His-tagged uspB to Ni-NTA resin

    • Wash with Tris/PBS-based buffer containing low concentrations of imidazole (20-30 mM)

    • Elute with a step or linear gradient of imidazole (30-200 mM)

  • Additional Purification (if needed):

    • Size exclusion chromatography to remove aggregates and impurities

    • Ion exchange chromatography can further enhance purity

  • Buffer Exchange:

    • Final storage buffer: Tris/PBS-based buffer containing 6% trehalose, pH 8.0

    • Addition of 5-50% glycerol for long-term storage

The purified protein remains soluble at high concentrations (20-30 mg/mL) even after prolonged storage at 4°C when properly prepared .

How can researchers assess the biological activity of purified recombinant uspB?

Multiple complementary approaches can be employed to verify biological activity of purified recombinant uspB:

  • ATP-Binding Assay: Though not definitively confirmed for uspB, many universal stress proteins bind ATP. Measuring binding affinity using techniques such as isothermal titration calorimetry (ITC) or fluorescence-based assays can indicate functional integrity.

  • Stress Protection Assays:

    • Complementation studies in uspB knockout strains

    • Bacterial survival assays under various stress conditions (oxidative stress, pH stress, high osmolarity)

    • Colony-forming unit (CFU) counts following stress exposure

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Thermal shift assays to evaluate protein stability

    • Limited proteolysis to assess proper folding

  • Protein-Protein Interaction Studies:

    • Pull-down assays to identify binding partners

    • Bacterial two-hybrid systems to validate interactions

What stress conditions modulate uspB expression and function in Salmonella paratyphi A?

Research has demonstrated that uspB expression is regulated by various environmental stressors:

Stress ConditionEffect on uspB ExpressionExperimental Evidence
Oxidative stress (H₂O₂)UpregulationImmunoblotting assays show increased protein levels
Low pH (pH 4.5)UpregulationEnhanced survival in uspB-expressing strains
High osmolarity (3M NaCl)UpregulationDifferential expression observed in survival assays
Heat shock (42°C)UpregulationDetected by immunoblotting of heat-extracted proteins
Nutrient starvationModerate upregulationGrowth-dependent regulation patterns

These findings suggest that uspB plays a critical role in the adaptation of Salmonella paratyphi A to various stressful environments encountered during host infection and environmental persistence .

What controls should be included when studying uspB function in stress response experiments?

When designing experiments to investigate uspB function in stress response, several critical controls should be included:

  • Genetic Controls:

    • Wild-type strain (positive control)

    • uspB deletion mutant (ΔuspB)

    • Complemented strain (ΔuspB + plasmid-encoded uspB)

    • Empty vector control for complementation studies

  • Treatment Controls:

    • Unstressed bacteria (baseline control)

    • Stress dosage gradient to establish dose-response relationships

    • Time course analysis to capture temporal dynamics

    • Recovery phase monitoring post-stress

  • Methodological Controls:

    • Molecular weight markers for protein expression analysis

    • Housekeeping gene expression controls (e.g., rpoD) for normalization

    • Cross-reactivity controls for antibody specificity

    • Vehicle controls for chemical stressors

  • Statistical Considerations:

    • Biological replicates (n≥3) from independent experiments

    • Technical replicates to assess methodological variation

    • Appropriate statistical tests based on data distribution

Following proper experimental design guidelines ensures reliable and reproducible results when investigating uspB function .

How can contradictions in uspB functional studies be resolved through experimental design?

When faced with contradictory results in uspB functional studies, researchers should implement the following methodological approaches:

  • Standardize Experimental Conditions:

    • Define precise growth conditions (medium composition, temperature, aeration)

    • Standardize stress parameters (duration, intensity, application method)

    • Use consistent bacterial growth phases across experiments

  • Control for Strain Variations:

    • Document complete strain histories and genetic backgrounds

    • Verify strain identities through whole-genome sequencing when necessary

    • Perform complementation studies to confirm phenotype attribution

  • Employ Multiple Detection Methods:

    • Combine transcriptomic, proteomic, and functional analyses

    • Use both qualitative and quantitative approaches

    • Implement both in vitro and in vivo models when applicable

  • Address Technical Biases:

    • Implement blinding procedures during data collection and analysis

    • Randomize sample processing order

    • Pre-register experimental protocols to minimize reporting bias

  • Conduct Meta-Analysis:

    • Systematically compare methodologies across contradictory studies

    • Identify experimental variables that correlate with outcome differences

    • Develop consensus protocols based on reproducible findings

How can recombinant uspB be utilized in vaccine development against Salmonella paratyphi A?

Recombinant uspB shows promise as a component in vaccine development strategies against Salmonella paratyphi A through several approaches:

  • Conjugate Vaccine Design:

    • O-linked glycosylation systems can be used to develop uspB-based conjugate vaccines

    • The specialized O-polysaccharide structure of S. paratyphi A requires specific O-linked glycosylation approaches

    • Recombinant strains with longer O-polysaccharide chains coupled with uspB show enhanced immunogenicity

  • Immunological Assessment:

    • uspB-based vaccines can evoke IgG1 antibody responses to O-antigen of S. paratyphi A

    • These vaccines elicit bactericidal activity against S. paratyphi A reference strains and epidemic isolates

    • Antigenic peptides can be added to the glycosylation site to improve immune response

  • Production Optimization:

    • Replacement of peptides after the glycosylation site (Ser) with antigenic peptides (e.g., P2) can enhance:

      • Anti-lipopolysaccharide antibody titers

      • Bactericidal activity of serum

      • Protective effects during animal challenge studies

This approach provides an economical method for S. paratyphi A conjugate vaccine production with potential for further optimization through precise conjugate vaccine design .

How does uspB contribute to Salmonella paratyphi A pathogenesis during host infection?

The role of uspB in Salmonella paratyphi A pathogenesis involves several mechanisms:

  • Stress Adaptation During Infection:

    • uspB contributes to bacterial survival during exposure to host defense mechanisms

    • Expression is upregulated in response to oxidative stress generated by host immune cells

    • Contributes to bacterial persistence in macrophages

  • Host-Pathogen Interactions:

    • May interact with NF-κB signaling pathways during infection

    • Potential role in modulating host inflammatory responses

    • Works in concert with other virulence factors to establish infection

  • Metabolic Adaptation:

    • Helps bacteria adapt to nutrient-limited environments within host tissues

    • May contribute to the distinct metabolite profiles observed during S. paratyphi A infection

    • Facilitates bacterial adaptation to changing metabolic conditions during infection progression

Understanding these pathogenesis mechanisms provides insights for developing targeted therapeutic strategies against enteric fever caused by S. paratyphi A .

What advanced techniques can be employed to study uspB protein-protein interactions and regulatory networks?

To elucidate the complex protein-protein interactions and regulatory networks involving uspB, several cutting-edge techniques can be employed:

  • Proximity-Based Protein Labeling:

    • BioID or APEX2 fusion proteins to identify proteins in close proximity to uspB

    • In situ labeling during different stress conditions to capture condition-specific interactions

    • MS-based identification of labeled proteins

  • Interactome Mapping:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Crosslinking mass spectrometry (XL-MS) to capture transient interactions

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify binding interfaces

  • High-Resolution Imaging:

    • Super-resolution microscopy to visualize subcellular localization

    • Single-molecule tracking to monitor dynamics in living bacterial cells

    • Correlative light and electron microscopy (CLEM) for structural context

  • Systems Biology Approaches:

    • Integration of transcriptomics and proteomics data with protein-protein interaction networks

    • Network analysis to identify key regulators and pathway connections

    • Mathematical modeling to predict system behavior under different conditions

  • CRISPR-Based Technologies:

    • CRISPRi for targeted gene repression to study network effects

    • CRISPR-based screening to identify genetic interactions

    • CRISPR-mediated tagging for endogenous protein labeling

These advanced techniques provide comprehensive insights into uspB's role within the complex stress response network of Salmonella paratyphi A .

How does Salmonella paratyphi A uspB compare to homologs in other enteric pathogens?

Comparative analysis of uspB across various enteric pathogens reveals important evolutionary relationships and functional distinctions:

OrganismProtein HomologSequence Identity (%)Functional DifferencesEvolutionary Significance
Salmonella paratyphi AuspB100 (reference)-Reference strain
Shigella sonneiMultispecies UspF100Similar stress responsesHighly conserved function
E. coli MS 69-1Universal Stress Family Protein99.4Nearly identical functionRecent evolutionary divergence
E. coli O157:H7Filament Protein85.7Additional structural rolesFunctional adaptation
E. coli K-12Stress-induced ATP-binding protein85.1Confirmed ATP-binding activityFunctional specialization
Salmonella enterica TennesseePutative Universal Stress Protein78.6Serovar-specific adaptationsDivergent evolution within genus
Citrobacter freundiiuspB homolog33.3 (presence)Less frequent occurrenceMore distant evolutionary relationship

This comparative analysis demonstrates that uspB is highly conserved among closely related enteric pathogens, particularly between Salmonella paratyphi A and Shigella species, suggesting critical functional importance. The presence of uspB homologs across diverse enterobacterial species highlights its ancient evolutionary origin and fundamental role in bacterial stress responses .

What is the prevalence of uspB across different Salmonella serovars and what does this suggest about its evolutionary importance?

The distribution pattern of uspB across Salmonella serovars provides valuable insights into its evolutionary significance:

This prevalence pattern reinforces the notion that uspB belongs to a conserved group of proteins involved in stress resistance, supporting bacterial survival during exposure to adverse conditions .

What emerging technologies could advance our understanding of uspB function in Salmonella paratyphi A?

Several cutting-edge technologies hold promise for deepening our understanding of uspB function:

  • Cryo-Electron Microscopy (Cryo-EM):

    • High-resolution structural determination of uspB protein complexes

    • Visualization of conformational changes upon stress induction

    • Mapping of protein-protein interaction interfaces at near-atomic resolution

  • Single-Cell Technologies:

    • Single-cell RNA sequencing to capture cell-to-cell variability in uspB expression

    • Single-cell proteomics to identify rare cellular states during stress responses

    • Microfluidics-based approaches to monitor real-time stress responses at single-cell level

  • Genome Editing and Synthetic Biology:

    • CRISPR-based precise genome modification to introduce point mutations

    • Synthetic promoter libraries to study uspB regulation

    • Optogenetic control of uspB expression to manipulate stress responses with temporal precision

  • Advanced Computational Approaches:

    • Deep learning algorithms to predict protein-protein interactions

    • Molecular dynamics simulations to model uspB structural dynamics

    • Network medicine approaches to position uspB within host-pathogen interaction networks

  • Multi-Omics Integration:

    • Integrated transcriptomics, proteomics, and metabolomics analyses

    • Spatial transcriptomics to map uspB expression patterns during infection

    • Temporal multi-omics to capture dynamic responses to stress conditions

These technologies promise to provide unprecedented insights into uspB function, potentially revealing new therapeutic targets for treating Salmonella paratyphi A infections .

What are the key unresolved questions about uspB that warrant further investigation?

Despite progress in understanding uspB, several critical questions remain unanswered and merit focused research efforts:

  • Structural Biology:

    • What is the complete three-dimensional structure of Salmonella paratyphi A uspB?

    • Does uspB undergo conformational changes during stress response?

    • What are the key structural determinants for uspB function?

  • Regulatory Mechanisms:

    • What transcription factors directly control uspB expression?

    • How is uspB regulated post-transcriptionally and post-translationally?

    • What signaling pathways modulate uspB during different stress conditions?

  • Functional Interactions:

    • What are the direct binding partners of uspB during stress response?

    • Does uspB form functional complexes with other stress response proteins?

    • How does uspB interact with host cellular components during infection?

  • Host-Pathogen Interface:

    • Does uspB contribute to immune evasion mechanisms?

    • Can uspB be recognized by host pattern recognition receptors?

    • What is the role of uspB in establishing persistent infections?

  • Therapeutic Applications:

    • Can uspB be targeted for antimicrobial development?

    • What epitopes of uspB are most immunogenic for vaccine design?

    • Could uspB inhibitors enhance antibiotic efficacy against Salmonella paratyphi A?

Addressing these questions will significantly advance our understanding of uspB biology and potentially lead to novel therapeutic strategies against Salmonella paratyphi A infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.