Recombinant Salmonella paratyphi A UPF0059 membrane protein yebN (yebN)

Shipped with Ice Packs
In Stock

Description

Introduction to Salmonella paratyphi A and the yebN Protein

Salmonella paratyphi A is a significant human pathogen responsible for paratyphoid fever, a systemic infection similar to typhoid fever but generally with milder symptoms. This bacterium belongs to the Salmonella enterica species, which causes a broad spectrum of diseases including gastroenteritis, bacteremia, and life-threatening conditions . Within the complex cellular machinery of this pathogen, membrane proteins play crucial roles in various physiological processes including nutrient transport, signal transduction, and virulence factor secretion.

The UPF0059 membrane protein yebN represents a specialized membrane protein family present in Salmonella paratyphi A. The designation "UPF" (Uncharacterized Protein Family) indicates that while this protein has been identified and sequenced, its precise biological function remains incompletely characterized . As a membrane protein, yebN likely serves important roles in cellular processes that may contribute to bacterial survival and potentially to pathogenesis.

Genetic Context and Conservation

The yebN gene in Salmonella paratyphi A is identified by the ordered locus name SPA1039, indicating its position within the bacterial genome . This localization within the genome can provide important context about potential operons or gene clusters that might suggest functional relationships with neighboring genes.

Interestingly, a homologous protein exists in Salmonella paratyphi B, sharing significant sequence similarity but potentially with species-specific adaptations . This conservation across different Salmonella serovars suggests the protein may serve a fundamental role in Salmonella biology rather than a strain-specific function.

Recombinant Expression Systems

The recombinant Salmonella paratyphi A UPF0059 membrane protein yebN is produced through heterologous expression systems that allow for controlled production and purification of the protein for research applications . While the specific expression system is not detailed in the available information, recombinant technologies typically involve cloning the target gene into appropriate expression vectors followed by expression in suitable host organisms, such as Escherichia coli.

The recombinant protein may include affinity tags to facilitate purification, though the specific tag type is determined during the production process according to the available product information . Such tags enable efficient purification through affinity chromatography while minimizing interference with protein structure and function.

Membrane Transport and Cellular Homeostasis

While the specific function of yebN remains to be fully elucidated, its classification as a membrane protein suggests potential roles in transport processes across the bacterial membrane. Other UPF family proteins have been implicated in various transport functions including ion transport, nutrient uptake, or export of cellular metabolites .

The membrane localization of yebN may be particularly significant in the context of Salmonella's intracellular lifestyle. Salmonella species are known to reside within host cells in specialized vacuolar compartments, requiring sophisticated membrane transport systems to acquire nutrients and export virulence factors .

Comparative Analysis with Related Proteins

Comparing yebN with other membrane proteins from Salmonella provides valuable insights into its potential functions. For instance, the UPF0060 membrane protein YnfA from the same organism (Salmonella paratyphi A) represents another uncharacterized protein family with potential membrane-associated functions .

Another interesting comparison is with the UPF0059 membrane protein yebN from Salmonella paratyphi B, which shares a high degree of sequence similarity . The amino acid sequence of the S. paratyphi B yebN protein is nearly identical to that of S. paratyphi A, suggesting conserved functions across these related serovars.

Host-Pathogen Interactions

While direct evidence connecting yebN to Salmonella pathogenesis is limited in the available research, the importance of membrane proteins in bacterial virulence is well-established. Membrane proteins often mediate crucial interactions with host cells and contribute to survival within the challenging host environment .

Salmonella Paratyphi A is known to exhibit intracellular motility and distinctive gene expression patterns during human epithelial cell infection, with numerous membrane-associated proteins playing key roles in this process . Research has identified significant differences between S. Paratyphi A and S. Typhimurium in their intracellular transcriptomic architecture and cellular phenotypes, highlighting the specialized adaptations of these pathogens .

Relationship to Bacterial Secretion Systems

The potential role of yebN in relation to Salmonella's specialized secretion systems represents an intriguing avenue for investigation. Salmonella species utilize sophisticated protein export machinery to deliver virulence factors into host cells. For example, Salmonella Typhi employs a dedicated protein secretion system to export typhoid toxin from the Salmonella-containing vacuole to the extracellular space via vesicle carriers .

Current Research Tools

Recombinant Salmonella paratyphi A UPF0059 membrane protein yebN is commercially available as a research reagent, typically supplied in quantities of 50 μg with additional quantities available upon request . The current market price for this recombinant protein is approximately $1,533.00, reflecting the specialized nature of this research tool .

The availability of purified recombinant yebN enables various research applications, including:

  1. Structural studies to determine three-dimensional protein conformation

  2. Functional assays to investigate transport activities

  3. Protein-protein interaction studies to identify binding partners

  4. Immunological research including antibody development

  5. Drug discovery efforts targeting bacterial membrane proteins

Diagnostic and Therapeutic Potential

Membrane proteins from pathogenic bacteria often represent valuable targets for diagnostic and therapeutic development. While specific applications of yebN in these contexts remain to be established, other membrane-associated proteins from Salmonella have demonstrated utility as diagnostic markers and drug targets.

For example, Hemolysin E (HlyE) from Salmonella Typhi has been identified as an antigen capable of discriminating between typhoid patients and control subjects, highlighting the diagnostic potential of specific bacterial proteins . Similar applications might be possible for yebN if its role in pathogenesis is confirmed through further research.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific requirements for the format, please indicate your preference when placing the order, and we will prepare according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; yebN; SPA1039; Probable manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
mntP
Target Protein Sequence
MHFTATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGLGIL ASKFVLEWNHWIAFVLLIFLGGRMIIEGIRGGSDEDETPLRRHSFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMIGRFIGPMLGKRAEILGGVVLIGIGVQ ILWTHFHG
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links

KEGG: spt:SPA1039

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.