Recombinant Salmonella paratyphi A UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
yqhA; SSPA2818; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
yqhA
Target Protein Sequence
MERFLENVMYASRWLLAPVYFGLSLALIALALKFFQEILHVLPNVFALAEADLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISAGKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links

KEGG: sek:SSPA2818

Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0114 protein YqhA in Salmonella paratyphi A?

UPF0114 protein YqhA is a membrane protein found in Salmonella paratyphi A, a Gram-negative enterobacterium that causes paratyphoid fever. The protein belongs to the UPF0114 family of uncharacterized proteins. This protein is encoded by the yqhA gene, which is present in different strains of Salmonella paratyphi A including strain AKU_12601 (locus name SSPA2818) and strain ATCC 9150/SARB42 (locus name SPA3021) . The protein consists of 164 amino acids and likely functions as a transmembrane protein, as suggested by its hydrophobic amino acid profile. While its precise function remains to be fully elucidated, structural analysis indicates it may play a role in the membrane biology of this pathogen.

How should recombinant Salmonella paratyphi A YqhA protein be stored for optimal research applications?

For optimal storage and stability of recombinant Salmonella paratyphi A YqhA protein, the following conditions are recommended based on manufacturer protocols:

  • Long-term storage: Store at -20°C or -80°C in a Tris-based buffer containing 50% glycerol.

  • Working aliquots: Store at 4°C for up to one week.

  • Avoid repeated freeze-thaw cycles as this may lead to protein denaturation and loss of activity.

  • Aliquot the protein upon initial thawing to minimize freeze-thaw cycles .

These storage recommendations are critical for maintaining protein integrity for experimental applications, especially considering the membrane protein nature of YqhA that makes it potentially more susceptible to denaturation compared to soluble proteins.

What are the expression systems used for producing recombinant YqhA protein?

Recombinant YqhA protein can be produced using several expression systems, each with distinct advantages depending on the research application:

The expression region for YqhA encompasses amino acids 1-164, representing the full-length protein . The choice of expression system should be guided by the specific requirements of downstream applications, with consideration for protein folding, post-translational modifications, and experimental endpoint.

How can recombinant YqhA protein be utilized in Salmonella paratyphi A genomic surveillance studies?

Recombinant YqhA protein can serve as a valuable tool in genomic surveillance studies of Salmonella paratyphi A through several methodological approaches:

  • Antibody development: Purified recombinant YqhA can be used to develop specific antibodies for detection assays. These antibodies can help track protein expression levels across different isolates and under various conditions.

  • Structure-function analysis: By comparing YqhA sequences from different clinical isolates, researchers can identify conserved regions that may be essential for protein function versus variable regions that might contribute to strain-specific characteristics.

  • Complementation to the Paratype genotyping system: While the Paratype system uses SNP-based genotyping to classify Salmonella paratyphi A into 3 primary clades, 9 secondary clades, and 18 genotypes, protein-level studies of YqhA could provide additional insights into functional consequences of genetic variations .

  • Host-pathogen interaction studies: Purified YqhA can be used in binding assays to identify potential host cell receptors or interaction partners, enhancing our understanding of Salmonella paratyphi A pathogenesis.

  • ELISA-based epidemiological studies: Recombinant YqhA can be employed in ELISA tests to detect anti-YqhA antibodies in patient sera, potentially contributing to surveillance of population exposure patterns .

The integration of protein-level data with genomic surveillance tools like Paratype could provide a more comprehensive understanding of Salmonella paratyphi A epidemiology and evolution.

What is the potential relationship between YqhA and antimicrobial resistance in Salmonella paratyphi A?

While direct evidence linking YqhA to antimicrobial resistance in Salmonella paratyphi A is limited in the provided search results, several research approaches can be employed to investigate potential relationships:

  • Comparative expression analysis: Researchers can examine YqhA expression levels in antimicrobial-resistant versus susceptible strains. Significant differences might suggest a role in resistance mechanisms.

  • Co-occurrence analysis: The genomic context of YqhA can be analyzed alongside known resistance genes. According to the surveillance data, most Salmonella Paratyphi A isolates (98%) lack predicted antimicrobial resistance genes, though 85% carry mutations in the QRDR region conferring fluoroquinolone resistance .

  • Structure-function investigation: The membrane localization of YqhA suggests it could potentially influence drug influx/efflux processes. Experiments with recombinant YqhA could involve reconstitution in liposomes to test permeability to various antimicrobials.

  • Gene knockout/complementation studies: Creating yqhA knockout strains and measuring changes in antimicrobial susceptibility, followed by complementation with recombinant protein, could directly test functional relationships.

  • Protein-protein interaction studies: Recombinant YqhA could be used in pull-down assays to identify binding partners potentially involved in drug resistance mechanisms.

These experimental approaches would help elucidate whether YqhA plays a direct role in the emerging antimicrobial resistance patterns observed in Salmonella Paratyphi A, particularly in relation to the increasing prevalence of QRDR mutations first identified in 1997 .

What methodological approaches are recommended for studying YqhA function in vitro?

To effectively study YqhA function in vitro, researchers should consider the following methodological approaches:

  • Protein purification optimization:

    • Use detergent screening to identify optimal solubilization conditions

    • Consider lipid nanodiscs or amphipols for maintaining native conformation

    • Implement size-exclusion chromatography to ensure monodispersity

  • Structural characterization:

    • Circular dichroism spectroscopy to assess secondary structure

    • X-ray crystallography or cryo-EM for high-resolution structure determination

    • NMR for dynamics studies of smaller domains

  • Functional assays:

    • Reconstitution in liposomes to test potential transport functions

    • Electrophysiology measurements if channel activity is suspected

    • Binding assays with potential substrates or interacting partners

  • Expression system selection:

    • For membrane proteins like YqhA, E. coli expression systems with specialized strains (C41/C43) designed for membrane protein expression may be advantageous

    • Consider cell-free expression systems for difficult-to-express constructs

  • Site-directed mutagenesis:

    • Target conserved residues across Salmonella species

    • Focus on charged residues in predicted transmembrane regions

    • Create deletion constructs to identify essential domains

When implementing these methods, it's crucial to include appropriate controls and validate findings through multiple complementary techniques to build a robust understanding of YqhA function.

How does YqhA vary across different genotypes in the Paratype classification system?

Analysis of YqhA variation across different genotypes in the Paratype classification system reveals important insights into protein conservation and evolution:

The Paratype genotyping system categorizes Salmonella Paratyphi A into 3 primary clades, 9 secondary clades, and 18 distinct genotypes based on SNP profiles . While the Paratype system primarily focuses on whole-genome SNP analysis, examination of YqhA sequences across these genotypes can provide protein-level insights.

Based on genomic surveillance data across 1379 isolates spanning 37 countries from 1917-2019, researchers can analyze:

  • Conservation patterns: YqhA appears to be highly conserved at the amino acid level across most genotypes, suggesting functional importance.

  • Correlation with antimicrobial resistance: While YqhA itself does not appear to be a primary resistance determinant, its sequence variants could potentially be associated with specific genotypes that show different resistance profiles. For instance, genotype 2.3 isolates from 1999-2004 were found to contain IncHI1 plasmids carrying resistance genes for trimethoprim, chloramphenicol, and sometimes ampicillin .

  • Geographic distribution: Comparison of YqhA sequences from different geographic regions represented in the Paratype database may reveal region-specific variations.

Future research directions could include targeted analysis of YqhA across the 18 genotypes identified by Paratype, which could potentially identify genotype-specific variations that might have functional consequences for protein activity or host-pathogen interactions.

What is known about the relationship between YqhA and Salmonella paratyphi A pathogenicity?

While direct evidence linking YqhA to Salmonella paratyphi A pathogenicity is limited in the provided search results, several research-based hypotheses can be proposed:

  • Membrane localization: As a membrane protein, YqhA may contribute to bacterial surface properties that affect host cell interactions or immune recognition.

  • Conservation: The high conservation of YqhA across Salmonella strains suggests functional importance, potentially in processes essential for pathogenicity.

  • Experimental approaches to investigate pathogenicity relationships:

    • Knockout studies comparing virulence in animal models

    • Adhesion/invasion assays with epithelial cell lines

    • Survival studies in macrophage infection models

    • Competitive index experiments comparing wild-type and yqhA mutants

    • Transcriptomic analysis during infection to assess yqhA expression

  • Potential roles based on predicted structure:

    • Membrane integrity maintenance

    • Nutrient acquisition in host environments

    • Stress response during host colonization

    • Contribution to biofilm formation

Future studies could utilize recombinant YqhA protein in interaction studies with host proteins or employ antibodies against YqhA to track its expression and localization during different stages of infection, potentially revealing its role in pathogenicity.

What are the challenges in expressing and purifying recombinant YqhA for research applications?

Expressing and purifying membrane proteins like YqhA presents several technical challenges that researchers should address methodically:

  • Expression system optimization:

    • Bacterial systems: May encounter toxicity due to membrane protein overexpression

    • Eukaryotic systems: Lower yields but potentially better folding

    • Recommended approach: Test multiple systems (E. coli, yeast, baculovirus, or mammalian cells) to determine optimal expression

  • Solubilization challenges:

    • Membrane proteins require careful detergent selection

    • Screening protocol: Test multiple detergents (DDM, LMNG, OG) at various concentrations

    • Alternative approach: Consider amphipols or nanodiscs for maintaining native conformation

  • Purification strategies:

    • Multi-step purification is typically required:
      a. Affinity chromatography (His-tag, GST-tag)
      b. Size exclusion chromatography
      c. Ion exchange chromatography if needed

    • Critical quality control points: SDS-PAGE, Western blot, mass spectrometry

  • Storage optimization:

    • Store in Tris-based buffer with 50% glycerol at -20°C or -80°C

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be maintained at 4°C for up to one week

  • Functional validation:

    • Circular dichroism to confirm proper folding

    • Activity assays specific to predicted function

    • Binding studies if receptor/ligand interactions are suspected

By systematically addressing these challenges, researchers can successfully produce recombinant YqhA suitable for downstream applications in Salmonella paratyphi A research.

How can antibodies against YqhA be developed and utilized in research?

Development and utilization of antibodies against YqhA can significantly enhance research on Salmonella paratyphi A through the following methodological approaches:

  • Antibody development strategies:

    • Peptide antibodies: Target hydrophilic regions of YqhA predicted to be exposed

    • Recombinant protein immunization: Use purified YqhA or soluble domains

    • Genetic immunization: DNA vaccines encoding YqhA for in vivo expression

  • Antibody validation protocols:

    • Western blot against recombinant protein and native Salmonella lysates

    • Immunoprecipitation coupled with mass spectrometry

    • Immunofluorescence microscopy to confirm subcellular localization

    • ELISA to establish detection limits and cross-reactivity

  • Research applications:

    • Immunohistochemistry to track Salmonella paratyphi A infection in tissue samples

    • Flow cytometry to quantify YqhA expression levels across different conditions

    • Chromatin immunoprecipitation if YqhA interacts with nucleic acids

    • Immunoprecipitation to identify protein-protein interactions

  • Diagnostic potential:

    • Development of ELISA-based detection methods for clinical samples

    • Lateral flow assays for rapid field detection

    • Comparison with existing antibody-based detection methods for Salmonella

  • Cross-reactivity considerations:

    • Test against related Salmonella species to determine specificity

    • Evaluate potential cross-reactivity with host proteins

    • Preabsorption strategies to improve specificity if needed

Antibodies against YqhA could complement genomic surveillance approaches like Paratype by providing protein-level detection capabilities, potentially revealing expression patterns across different genotypes and clinical contexts .

What are promising future research areas for YqhA in Salmonella paratyphi A studies?

Several promising research directions can advance our understanding of YqhA in Salmonella paratyphi A:

  • Structural biology approaches:

    • High-resolution structural determination through X-ray crystallography or cryo-EM

    • Computational modeling to predict ligand binding sites

    • Molecular dynamics simulations to understand conformational changes

    • Structure-guided drug design targeting YqhA if validated as important for virulence

  • Functional characterization:

    • Transcriptomic analysis to identify conditions that regulate yqhA expression

    • Systematic mutagenesis to identify essential residues

    • Protein-protein interaction mapping to place YqhA in cellular pathways

    • Metabolomic profiling of yqhA knockout strains to identify affected pathways

  • Integration with Paratype surveillance:

    • Correlation of YqhA variants with the 18 genotypes identified in Paratype

    • Investigation of YqhA in historically significant isolates from the global collection

    • Analysis of YqhA expression in drug-resistant strains, particularly those with QRDR mutations

  • Host-pathogen interactions:

    • Identification of host cell receptors or targets

    • Investigation of immune recognition of YqhA

    • Examination of YqhA role in intracellular survival

    • Evaluation as a potential vaccine candidate

  • Comparative studies across Salmonella species:

    • Functional comparison of YqhA between S. paratyphi A, S. typhi, and non-typhoidal Salmonella

    • Investigation of YqhA role in host adaptation and specificity

    • Evolutionary analysis of selective pressures on yqhA gene

These research directions would contribute to a more comprehensive understanding of YqhA biology and potentially reveal new therapeutic or diagnostic targets for paratyphoid fever management.

How might YqhA research contribute to vaccine or therapeutic development for Salmonella paratyphi A?

Research on YqhA could significantly impact vaccine and therapeutic development for Salmonella paratyphi A through several promising approaches:

  • Vaccine development potential:

    • Subunit vaccine: If YqhA contains immunogenic epitopes, recombinant protein could be evaluated as a vaccine component

    • Epitope mapping: Identification of protective B and T cell epitopes within YqhA

    • Carrier protein: YqhA could potentially serve as a carrier for conjugate vaccines

    • Live attenuated vaccines: Modulation of yqhA expression in attenuated strains

  • Therapeutic targeting strategies:

    • Small molecule inhibitors: If YqhA is essential for pathogenesis, structure-based drug design could yield specific inhibitors

    • Antibody-based therapeutics: Humanized antibodies against surface-exposed YqhA epitopes

    • Antimicrobial peptides: Design of peptides that specifically interact with YqhA

    • Combination therapies: YqhA inhibitors used alongside conventional antibiotics

  • Diagnostic applications:

    • Development of YqhA-based detection systems for clinical samples

    • Differentiation between vaccine-induced and infection-induced immunity

    • Point-of-care testing based on YqhA detection

  • Context within current challenges:

    • Rising antimicrobial resistance: With no licensed vaccines available and increasing QRDR mutations (present in 85% of isolates), YqhA represents a novel target

    • Need for surveillance tools: YqhA-based assays could complement genomic surveillance with Paratype

  • Research roadmap:

    • Preclinical: Immunogenicity and protection studies in animal models

    • Safety assessment: Evaluation of cross-reactivity with human proteins

    • Formulation studies: Stability, delivery systems, adjuvant requirements

    • Clinical trial considerations: Target populations in endemic regions

The development of YqhA-based interventions would be particularly valuable given the global burden of 3.4 million Salmonella Paratyphi A infections annually and the concerning trend of antimicrobial resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.