Recombinant Salmonella paratyphi A UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development to meet your needs.
Synonyms
yfbV; SSPA0492; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYAKTWPMEKRLAPVFVENRVIRMTRYAIRFMPPVAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQEAGQAL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links

KEGG: sek:SSPA0492

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YfbV protein and what is its significance in Salmonella paratyphi A?

YfbV (also known as UPF0208 membrane protein) is a membrane-associated protein encoded by the yfbV gene in Salmonella paratyphi A. The protein consists of 151 amino acids and is classified as part of the UPF0208 protein family . While the precise biological function of YfbV remains under investigation, its conservation across Salmonella strains suggests an important role in bacterial physiology or pathogenesis.

Salmonella paratyphi A is one of the primary etiologic agents of paratyphoid fever, responsible for approximately 3.4 million infections annually worldwide . The increasing incidence of S. paratyphi A infections, coupled with rising antimicrobial resistance, has heightened interest in understanding the molecular components of this pathogen, including membrane proteins like YfbV that may serve as potential diagnostic markers or vaccine targets .

Expression Systems:

Recombinant YfbV from S. paratyphi A is typically expressed in heterologous systems, with E. coli being the most common expression host . Alternative expression systems include yeast, baculovirus, or mammalian cell culture systems, depending on experimental requirements .

Expression Protocol:

  • The yfbV gene (encoding residues 1-151) is PCR-amplified from S. paratyphi A genomic DNA

  • The amplified gene is cloned into an expression vector containing an N-terminal His-tag

  • The construct is transformed into E. coli expression strains (typically BL21(DE3) or derivatives)

  • Expression is induced using IPTG (isopropyl β-D-1-thiogalactopyranoside)

  • Cells are harvested and lysed using physical or chemical methods

Purification Methodology:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin to capture the His-tagged protein

  • Optional further purification using ion exchange or size exclusion chromatography

  • The purified protein is typically supplied as a lyophilized powder or in Tris-based buffer with glycerol

Quality Control:

Purity is assessed by SDS-PAGE, with commercial preparations typically achieving ≥85-90% purity . Western blotting with anti-His antibodies confirms identity of the recombinant protein.

What is the current epidemiological significance of Salmonella paratyphi A infections?

Salmonella paratyphi A is one of the causative agents of enteric fever, alongside S. Typhi and other Paratyphi serovars. Recent epidemiological trends indicate:

  • Increasing incidence of S. paratyphi A infections globally, with an estimated 3.4 million cases annually

  • Growing proportion of enteric fever cases attributed to S. paratyphi A compared to S. Typhi in certain regions

  • Emergence of antimicrobial resistance, particularly to fluoroquinolones through mutations in the QRDR region

  • Limited cross-protection from current typhoid vaccines against S. paratyphi A infections

A genomic surveillance study analyzing 1,379 S. paratyphi A isolates from 37 countries (1917-2019) revealed distinct genotypes with varying geographical distributions and antimicrobial resistance profiles . The development of the "Paratype" genotyping tool has enabled more effective tracking of S. paratyphi A transmission globally, revealing that 85% of analyzed genomes had mutations in the QRDR region associated with fluoroquinolone resistance .

What methodologies are used to investigate the functional role of YfbV in Salmonella paratyphi A?

While the specific function of YfbV remains under investigation, several methodologies can be employed to elucidate its role:

Gene Knockout Studies:

  • CRISPR-Cas9 or lambda Red recombineering to create yfbV deletion mutants

  • Phenotypic characterization of mutants through growth curves, stress resistance assays, and infection models

  • Complementation studies to confirm phenotype specificity

Protein Interaction Studies:

  • Bacterial two-hybrid systems to identify protein-protein interactions

  • Co-immunoprecipitation followed by mass spectrometry to identify interaction partners

  • Crosslinking studies to capture transient interactions within the membrane environment

Localization Studies:

  • Immunofluorescence microscopy using antibodies against YfbV

  • Fractionation studies to confirm membrane localization

  • GFP-fusion proteins to track localization in live cells

Functional Assays:

Based on homology to other UPF0208 family proteins, assays could focus on:

  • Membrane integrity assessment using dye leakage assays

  • Stress response measurements under various conditions

  • Virulence assessment in cell culture and animal models

How can recombinant YfbV be utilized in vaccine development against paratyphoid fever?

The development of vaccines against S. paratyphi A is a priority due to increasing incidence and antimicrobial resistance . YfbV, as a membrane protein, represents a potential vaccine candidate:

Immunogenicity Assessment:

  • Evaluation of humoral and cellular immune responses to purified recombinant YfbV in animal models

  • Analysis of antibody titers, cytokine profiles, and T cell responses

  • Assessment of cross-reactivity with other Salmonella serovars

Research on outer membrane proteins of S. paratyphi A has identified several immunogenic candidates. While YfbV specifically has not been prominently highlighted in the provided search results, other membrane proteins like LamB, PagC, TolC, NmpC, and FadL have shown significant immunoprotection in mouse models, with protection rates ranging from 70-95% .

Vaccine Formulation Approaches:

  • Subunit vaccines incorporating purified recombinant YfbV

  • DNA vaccines encoding the yfbV gene

  • Live attenuated S. paratyphi A strains expressing modified or overexpressed YfbV

  • Multivalent vaccines combining YfbV with other immunogenic components

Delivery Systems:

  • Adjuvant formulations to enhance immune responses

  • Nanoparticle encapsulation for targeted delivery

  • Mucosal delivery systems for inducing local immunity at sites of infection

An innovative approach for bivalent vaccine development involves engineering S. paratyphi A to express Vi capsular polysaccharide (naturally absent in S. paratyphi A but present in S. Typhi). This approach resulted in a vaccine candidate that provided protection against both pathogens in mouse models . Similar engineering approaches could potentially incorporate modified forms of YfbV to enhance immunogenicity.

Epitope Mapping:

  • Peptide array analysis using overlapping peptides spanning the YfbV sequence

  • Phage display libraries to identify antibody-binding epitopes

  • Hydrogen-deuterium exchange mass spectrometry to identify surface-exposed regions

Antibody Response Analysis:

  • ELISA to measure antibody titers in immunized animals or infected patients

  • Western blotting to assess antibody specificity

  • Surface plasmon resonance to determine antibody binding kinetics

Structural Immunology:

  • X-ray crystallography of YfbV-antibody complexes

  • Cryo-electron microscopy to visualize antibody binding sites

  • Computational modeling to predict antigenic determinants

Functional Immunology:

  • Serum bactericidal assays to assess antibody-mediated killing

  • Opsonophagocytosis assays to evaluate phagocytic clearance

  • Complement activation studies

Similar approaches have been used to characterize outer membrane proteins of S. paratyphi A, revealing that antisera against these proteins can confer significant passive immunoprotection in mice .

How does YfbV expression correlate with antimicrobial resistance in clinical isolates?

While direct correlations between YfbV expression and antimicrobial resistance have not been explicitly established in the provided search results, broader genomic and proteomic analyses of resistant S. paratyphi A strains can provide insights:

Genomic Analysis Approaches:

  • Whole-genome sequencing of resistant isolates to identify mutations or gene acquisitions

  • RNA-seq to compare transcriptional profiles between susceptible and resistant strains

  • Genome-wide association studies to correlate genetic variations with resistance phenotypes

Analysis of 1,379 S. paratyphi A genomes revealed that:

  • 98% had no predicted antimicrobial resistance genes

  • 85% had mutations in the QRDR region associated with fluoroquinolone resistance

  • The most common mutations were gyrA-S83F (68%) and gyrA-S83Y (15%)

  • Five genomes contained IncHI1 plasmids with resistance genes for trimethoprim, chloramphenicol, and in some cases ampicillin

Proteomic Analysis:

  • Comparative proteomics of membrane fractions from susceptible and resistant isolates

  • Targeted quantification of YfbV expression using targeted mass spectrometry

  • Post-translational modification analysis to identify regulatory mechanisms

Structure-Function Studies:

  • Site-directed mutagenesis of YfbV to assess impact on antimicrobial susceptibility

  • Overexpression and deletion studies to determine effects on minimum inhibitory concentrations

  • Drug binding assays to investigate potential interactions with antimicrobials

What are the challenges in developing serological diagnostic tests using recombinant YfbV?

Development of serological diagnostics for S. paratyphi A using YfbV presents several technical challenges:

Antigen Optimization:

  • Determining optimal expression conditions to maintain native conformation

  • Identifying immunodominant epitopes for test development

  • Addressing potential cross-reactivity with homologous proteins from other enteric bacteria

Sensitivity and Specificity Considerations:

  • Evaluating antibody responses across diverse patient populations

  • Determining the kinetics of anti-YfbV antibody development during infection

  • Establishing appropriate cutoff values for positivity

Technical Challenges:

  • Maintaining stability of membrane proteins in diagnostic formats

  • Developing detection systems suitable for resource-limited settings

  • Validating against gold standard culture-based methods

Clinical Validation:

  • Testing across different geographical regions with varying strain distributions

  • Evaluating performance in acute versus convalescent samples

  • Assessing utility for epidemiological surveillance versus individual diagnosis

A comparative table of potential diagnostic approaches using YfbV would include:

Diagnostic FormatPrincipleAdvantagesLimitations
ELISAAntibody detectionHigh throughput, quantitativeRequires specialized equipment
Lateral FlowRapid antibody detectionPoint-of-care use, minimal equipmentLower sensitivity
Protein MicroarrayMultiplexed antibody detectionMultiple targets assessed simultaneouslyComplex development, expensive
Cell-Based AssaysFunctional antibody assessmentMeasures neutralizing activityComplex, requires cell culture

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.