Recombinant Salmonella paratyphi A UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Salmonella paratyphi A UPF0283 Membrane Protein YcjF (YcjF)

Salmonella paratyphi A UPF0283 membrane protein YcjF (YcjF) is a protein associated with the bacterium Salmonella paratyphi A . Salmonella paratyphi A is a Gram-negative bacterium that causes paratyphoid fever A in humans .

  • YcjF is a membrane protein, which means it is located in the bacterial cell membrane . Membrane proteins are crucial for various cellular functions, including transport, signaling, and maintaining cell structure .

  • UPF0283 designates the protein as part of a protein family of unknown function (UPF) .

  • Recombinant refers to the protein being produced through recombinant DNA technology, where the gene encoding YcjF is inserted into a host organism (e.g., E. coli) to produce the protein in large quantities .

Gene Information and Characteristics

The ycjF gene encodes the YcjF protein. Synonyms for the ycjF gene include SSPA1115 and UPF0283 membrane protein YcjF . The protein is 353 amino acids long . Recombinant Salmonella paratyphi A UPF0283 membrane protein YcjF(YcjF) Protein, His-Tagged is expressed in E. coli .

Table 1: Protein Information

CategoryInformation
Gene NameycjF
SynonymsycjF; SSPA1115; UPF0283 membrane protein YcjF
UniProt IDB5BJ45
SpeciesSalmonella paratyphi A
SourceE. coli
TagHis
Protein LengthFull Length (1-353)
AA SequenceMSEPLKPRIDFAEPLKEEPTSAFKAQQTFSEAESRTFAPAAIDERPEDEGVAEAAVDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIVGAGVGSVV TEWRRLWRLRQRAHERDEARELLHSHSVGKGRAFCEKLAQQAGIDQSHPVLQRWYAAIHE TQNDREIVGLYANLVQPVLDAQARREISRFAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDNDKPRLGDFRRQLIGQLKETLQKSKSSPEK
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃.

Potential Functions and Research Applications

  • Immunogenicity: Outer membrane proteins of Salmonella species, including S. Paratyphi A, have been recognized as excellent immunogens . Immunogenic outer membrane proteins of S. Paratyphi A may offer immunoprotection .

  • Vaccine Development: Recombinant proteins like YcjF can be used as antigens in vaccines to stimulate an immune response and provide protection against Salmonella infections .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your specifications.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ycjF; SSPA1115; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
ycjF
Target Protein Sequence
MSEPLKPRIDFAEPLKEEPTSAFKAQQTFSEAESRTFAPAAIDERPEDEGVAEAAVDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIVGAGVGSVV TEWRRLWRLRQRAHERDEARELLHSHSVGKGRAFCEKLAQQAGIDQSHPVLQRWYAAIHE TQNDREIVGLYANLVQPVLDAQARREISRFAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDNDKPRLGDFRRQLIGQLKETLQKSKSSPEK
Uniprot No.

Target Background

Database Links

KEGG: sek:SSPA1115

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0283 membrane protein ycjF and where is it found in bacterial genomes?

UPF0283 membrane protein ycjF belongs to the uncharacterized protein family (UPF) 0283, indicating its function remains largely unknown as classified in the COG (Clusters of Orthologous Groups) database under category S - Function unknown . The protein is conserved across multiple bacterial species, with notable presence in various Salmonella strains (including S. paratyphi A, S. gallinarum, and S. choleraesuis) and Escherichia coli .

In Salmonella paratyphi A, ycjF is a full-length protein comprising 353 amino acids, with a molecular weight of approximately 39.4 kDa . Its genomic context and high conservation across Enterobacteriaceae suggest potential importance in bacterial physiology, despite its currently undefined function.

What expression systems are recommended for producing recombinant Salmonella paratyphi A ycjF protein?

Multiple expression systems can be utilized for recombinant production of ycjF protein, each offering distinct advantages depending on research objectives:

Expression SystemAdvantagesConsiderationsTypical Applications
E. coliHighest yields, shorter turnaround times, cost-effectiveLimited post-translational modificationsBasic protein characterization, antibody production
YeastGood yields, some post-translational modificationsMore complex than E. coliStructural studies requiring some modifications
Baculovirus/Insect cellsAdvanced post-translational modificationsLonger production time, higher costFunctional studies requiring proper folding
Mammalian cellsMost complete post-translational modificationsLowest yields, highest cost, longest timeStudies requiring fully native protein conformation

What are the optimal storage conditions for maintaining stability of recombinant ycjF protein?

Proper storage of recombinant ycjF protein is critical for maintaining its stability and activity. Based on multiple supplier protocols, the following recommendations are consistent:

  • Primary storage: Store at -20°C/-80°C in a buffer containing 50% glycerol

  • Working aliquots: Store at 4°C for up to one week to avoid freeze-thaw cycles

  • Buffer composition: Tris-based buffer optimized for protein stability

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein stability

  • For long-term storage, aliquoting is necessary to minimize freeze-thaw cycles

  • Reconstitution (if lyophilized): Reconstitute to 0.1-1.0 mg/mL in deionized sterile water

These storage recommendations are consistent with general practices for membrane proteins, which are typically more sensitive to storage conditions than soluble proteins.

What methodological approaches can be employed to characterize the membrane topology of ycjF protein?

Given the challenges in determining membrane protein topology, a multi-faceted approach is recommended:

  • Computational prediction methods:

    • Use of topology prediction algorithms (TMHMM, HMMTOP, Phobius)

    • Hydrophobicity analysis to identify potential transmembrane segments

    • Signal peptide prediction tools to identify potential cleavage sites

  • Biochemical approaches:

    • Protease accessibility assays to identify exposed regions

    • Site-directed labeling with membrane-impermeable reagents

    • Glycosylation mapping with engineered glycosylation sites

  • Structural biology techniques:

    • Cryo-electron microscopy of membrane-embedded protein

    • X-ray crystallography of detergent-solubilized protein

    • NMR studies of isotopically labeled protein in nanodiscs

  • Genetic fusion techniques:

    • PhoA/GFP fusion analysis at different positions to determine orientation

    • Split-GFP complementation assays for topology mapping

    • TOXCAT/TOXR assays for transmembrane domain validation

These approaches should be used in combination as each has limitations when applied to membrane proteins like ycjF .

What strategies can overcome challenges in crystallizing ycjF for structural determination?

Membrane proteins like ycjF present significant crystallization challenges that can be addressed through specialized techniques:

  • Protein engineering strategies:

    • Truncation of disordered regions based on prediction algorithms

    • Introduction of stabilizing mutations identified through alanine scanning

    • Fusion with crystallization chaperones (T4 lysozyme, BRIL, rubredoxin)

    • Surface entropy reduction through cluster mutations of lysine/glutamate

  • Detergent and lipid optimization:

    • Systematic screening of detergent types (maltoside, glycoside, neopentyl glycol)

    • Bicelle and lipidic cubic phase crystallization methods

    • Nanodiscs and styrene maleic acid lipid particles (SMALPs) as alternatives

    • Addition of specific lipids that enhance stability

  • Advanced crystallization methods:

    • Lipidic cubic phase (LCP) crystallization

    • Antibody fragment co-crystallization to increase hydrophilic surface

    • Microseeding and controlled dehydration techniques

    • Counter-diffusion crystallization in capillaries

  • Alternative structural approaches:

    • Cryo-EM single particle analysis for high-resolution structure

    • Integrative structural biology combining multiple low-resolution data

    • X-ray free electron laser (XFEL) microcrystallography

The expression in different systems (E. coli, yeast, insect cells) may yield protein with different conformational properties that affect crystallization success .

How can potential post-translational modifications of ycjF be comprehensively mapped?

A systematic approach to mapping post-translational modifications (PTMs) of ycjF should include:

  • Mass spectrometry-based methods:

    • Bottom-up proteomics with multiple proteases for complete sequence coverage

    • Top-down proteomics for intact protein analysis

    • Middle-down approach for analysis of large peptides

    • Targeted MS approaches (PRM, MRM) for specific modification sites

  • Enrichment strategies for specific PTMs:

    • Metal oxide affinity chromatography for phosphorylation

    • Lectin affinity for glycosylation

    • Antibody-based enrichment for acetylation, methylation

    • Chemical labeling strategies for cysteine modifications

  • Site-directed mutagenesis validation:

    • Mutation of predicted modification sites to non-modifiable residues

    • Functional characterization of mutants

    • Comparative analysis of wild-type vs. mutant proteins

  • Expression system considerations:

    • Parallel analysis of protein expressed in different systems

    • Comparison of E. coli (minimal modifications) vs. mammalian (full modifications)

    • Use of inhibitors to block specific PTM pathways

These approaches should be tailored based on the specific PTMs suspected to occur on ycjF, which may include phosphorylation, glycosylation, and lipid modifications common to bacterial membrane proteins .

What functional genomics approaches can elucidate the role of ycjF in Salmonella paratyphi A physiology?

Given that ycjF remains functionally uncharacterized (UPF0283 family) , several complementary functional genomics approaches can be employed:

  • Genetic manipulation techniques:

    • CRISPR-Cas9 gene deletion or disruption with phenotypic characterization

    • Conditional knockdown systems (antisense RNA, CRISPRi)

    • Overexpression studies to identify gain-of-function phenotypes

    • Complementation studies with orthologs from other species

  • High-throughput phenotypic screening:

    • Biolog phenotype microarrays to identify growth conditions affected by ycjF deletion

    • Fitness profiling across diverse environmental conditions

    • Antibiotic susceptibility profiling

    • Stress response characterization (pH, temperature, osmotic shock)

  • Interaction studies:

    • Bacterial two-hybrid or split-ubiquitin membrane yeast two-hybrid

    • Co-immunoprecipitation coupled with mass spectrometry

    • Protein-lipid overlay assays

    • Crosslinking mass spectrometry for interaction partners

  • Transcriptomics and metabolomics:

    • RNA-seq comparing wild-type and ycjF mutant strains

    • ChIP-seq if DNA-binding activity is suspected

    • Untargeted metabolomics to identify affected metabolic pathways

    • Lipidomics to assess membrane composition changes

These approaches should be performed under multiple growth conditions, including those mimicking host infection environments, to capture condition-specific functions .

How can recombinant ycjF protein be evaluated as a potential biomarker or vaccine candidate for Salmonella paratyphi A?

Evaluation of ycjF as a biomarker or vaccine candidate requires systematic assessment of several key parameters:

  • Immunogenicity assessment:

    • Epitope mapping using overlapping peptide arrays

    • B-cell epitope prediction and validation

    • T-cell epitope identification through MHC binding assays

    • Animal immunization studies with recombinant protein

  • Specificity and conservation analysis:

    • Bioinformatic analysis of sequence conservation across Salmonella strains

    • Cross-reactivity testing with antibodies against related bacterial species

    • Assessment of expression levels during different growth phases and infection stages

    • Analysis of accessibility on bacterial cell surface

  • Functional evaluation in infection models:

    • Mouse infection models with wild-type vs. ycjF-deficient strains

    • Adherence and invasion assays in relevant cell types

    • Serum bactericidal assays using anti-ycjF antibodies

    • Opsonophagocytosis assays

  • Vaccine formulation considerations:

    • Conjugation to carrier proteins (like CRM₁₉₇ used in other Salmonella vaccines)

    • Formulation with appropriate adjuvants

    • Stability testing under various storage conditions

    • Dosage optimization and administration route studies

Recent work on S. Paratyphi A O-antigen glycoconjugate vaccines shows the importance of evaluating protection against diverse clinical isolates, suggesting similar principles would apply to ycjF-based approaches .

What advanced structural biology techniques are most promising for elucidating the three-dimensional structure of ycjF?

Given the challenges of membrane protein structural determination, several cutting-edge approaches are particularly promising for ycjF:

The successful application of these techniques requires careful optimization of recombinant protein production conditions to ensure proper folding and stability, particularly when expressing in E. coli systems .

How can protein-protein interaction networks involving ycjF be experimentally mapped in Salmonella paratyphi A?

Mapping the protein-protein interaction (PPI) network of ycjF requires specialized approaches for membrane proteins:

  • In vivo crosslinking strategies:

    • Photo-amino acid incorporation at specific positions

    • Chemical crosslinking with membrane-permeable reagents

    • In vivo biotinylation using proximity labeling (BioID, APEX)

    • Time-resolved crosslinking to capture dynamic interactions

  • Membrane-specific interaction techniques:

    • Split-ubiquitin membrane yeast two-hybrid

    • MYTH (membrane yeast two-hybrid) system

    • mSPINE (membrane-based single protein interaction engineering)

    • FRET/BRET-based interaction screening

  • Affinity purification approaches:

    • Tandem affinity purification with membrane-specific solubilization

    • Co-immunoprecipitation with epitope-tagged ycjF

    • Pull-down assays with recombinant protein fragments

    • Quantitative proteomics comparing wild-type vs. ycjF-deficient strains

  • Validation and functional characterization:

    • Bimolecular fluorescence complementation (BiFC) in bacterial cells

    • Protein fragment complementation assays

    • Surface plasmon resonance for binding kinetics

    • Bacterial three-hybrid systems for complex formation analysis

The integration of these multiple approaches is necessary to overcome technical challenges associated with membrane protein interactions and to distinguish true interactors from nonspecific associations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.