Salmonella paratyphi A UPF0283 membrane protein YcjF (YcjF) is a protein associated with the bacterium Salmonella paratyphi A . Salmonella paratyphi A is a Gram-negative bacterium that causes paratyphoid fever A in humans .
YcjF is a membrane protein, which means it is located in the bacterial cell membrane . Membrane proteins are crucial for various cellular functions, including transport, signaling, and maintaining cell structure .
UPF0283 designates the protein as part of a protein family of unknown function (UPF) .
Recombinant refers to the protein being produced through recombinant DNA technology, where the gene encoding YcjF is inserted into a host organism (e.g., E. coli) to produce the protein in large quantities .
The ycjF gene encodes the YcjF protein. Synonyms for the ycjF gene include SSPA1115 and UPF0283 membrane protein YcjF . The protein is 353 amino acids long . Recombinant Salmonella paratyphi A UPF0283 membrane protein YcjF(YcjF) Protein, His-Tagged is expressed in E. coli .
| Category | Information |
|---|---|
| Gene Name | ycjF |
| Synonyms | ycjF; SSPA1115; UPF0283 membrane protein YcjF |
| UniProt ID | B5BJ45 |
| Species | Salmonella paratyphi A |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-353) |
| AA Sequence | MSEPLKPRIDFAEPLKEEPTSAFKAQQTFSEAESRTFAPAAIDERPEDEGVAEAAVDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIVGAGVGSVV TEWRRLWRLRQRAHERDEARELLHSHSVGKGRAFCEKLAQQAGIDQSHPVLQRWYAAIHE TQNDREIVGLYANLVQPVLDAQARREISRFAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDNDKPRLGDFRRQLIGQLKETLQKSKSSPEK |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles. |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. |
Immunogenicity: Outer membrane proteins of Salmonella species, including S. Paratyphi A, have been recognized as excellent immunogens . Immunogenic outer membrane proteins of S. Paratyphi A may offer immunoprotection .
Vaccine Development: Recombinant proteins like YcjF can be used as antigens in vaccines to stimulate an immune response and provide protection against Salmonella infections .
KEGG: sek:SSPA1115
UPF0283 membrane protein ycjF belongs to the uncharacterized protein family (UPF) 0283, indicating its function remains largely unknown as classified in the COG (Clusters of Orthologous Groups) database under category S - Function unknown . The protein is conserved across multiple bacterial species, with notable presence in various Salmonella strains (including S. paratyphi A, S. gallinarum, and S. choleraesuis) and Escherichia coli .
In Salmonella paratyphi A, ycjF is a full-length protein comprising 353 amino acids, with a molecular weight of approximately 39.4 kDa . Its genomic context and high conservation across Enterobacteriaceae suggest potential importance in bacterial physiology, despite its currently undefined function.
Multiple expression systems can be utilized for recombinant production of ycjF protein, each offering distinct advantages depending on research objectives:
| Expression System | Advantages | Considerations | Typical Applications |
|---|---|---|---|
| E. coli | Highest yields, shorter turnaround times, cost-effective | Limited post-translational modifications | Basic protein characterization, antibody production |
| Yeast | Good yields, some post-translational modifications | More complex than E. coli | Structural studies requiring some modifications |
| Baculovirus/Insect cells | Advanced post-translational modifications | Longer production time, higher cost | Functional studies requiring proper folding |
| Mammalian cells | Most complete post-translational modifications | Lowest yields, highest cost, longest time | Studies requiring fully native protein conformation |
Proper storage of recombinant ycjF protein is critical for maintaining its stability and activity. Based on multiple supplier protocols, the following recommendations are consistent:
Primary storage: Store at -20°C/-80°C in a buffer containing 50% glycerol
Working aliquots: Store at 4°C for up to one week to avoid freeze-thaw cycles
Buffer composition: Tris-based buffer optimized for protein stability
Avoid repeated freeze-thaw cycles as this significantly reduces protein stability
For long-term storage, aliquoting is necessary to minimize freeze-thaw cycles
Reconstitution (if lyophilized): Reconstitute to 0.1-1.0 mg/mL in deionized sterile water
These storage recommendations are consistent with general practices for membrane proteins, which are typically more sensitive to storage conditions than soluble proteins.
Given the challenges in determining membrane protein topology, a multi-faceted approach is recommended:
Computational prediction methods:
Use of topology prediction algorithms (TMHMM, HMMTOP, Phobius)
Hydrophobicity analysis to identify potential transmembrane segments
Signal peptide prediction tools to identify potential cleavage sites
Biochemical approaches:
Protease accessibility assays to identify exposed regions
Site-directed labeling with membrane-impermeable reagents
Glycosylation mapping with engineered glycosylation sites
Structural biology techniques:
Cryo-electron microscopy of membrane-embedded protein
X-ray crystallography of detergent-solubilized protein
NMR studies of isotopically labeled protein in nanodiscs
Genetic fusion techniques:
PhoA/GFP fusion analysis at different positions to determine orientation
Split-GFP complementation assays for topology mapping
TOXCAT/TOXR assays for transmembrane domain validation
These approaches should be used in combination as each has limitations when applied to membrane proteins like ycjF .
Membrane proteins like ycjF present significant crystallization challenges that can be addressed through specialized techniques:
Protein engineering strategies:
Truncation of disordered regions based on prediction algorithms
Introduction of stabilizing mutations identified through alanine scanning
Fusion with crystallization chaperones (T4 lysozyme, BRIL, rubredoxin)
Surface entropy reduction through cluster mutations of lysine/glutamate
Detergent and lipid optimization:
Systematic screening of detergent types (maltoside, glycoside, neopentyl glycol)
Bicelle and lipidic cubic phase crystallization methods
Nanodiscs and styrene maleic acid lipid particles (SMALPs) as alternatives
Addition of specific lipids that enhance stability
Advanced crystallization methods:
Lipidic cubic phase (LCP) crystallization
Antibody fragment co-crystallization to increase hydrophilic surface
Microseeding and controlled dehydration techniques
Counter-diffusion crystallization in capillaries
Alternative structural approaches:
Cryo-EM single particle analysis for high-resolution structure
Integrative structural biology combining multiple low-resolution data
X-ray free electron laser (XFEL) microcrystallography
The expression in different systems (E. coli, yeast, insect cells) may yield protein with different conformational properties that affect crystallization success .
A systematic approach to mapping post-translational modifications (PTMs) of ycjF should include:
Mass spectrometry-based methods:
Bottom-up proteomics with multiple proteases for complete sequence coverage
Top-down proteomics for intact protein analysis
Middle-down approach for analysis of large peptides
Targeted MS approaches (PRM, MRM) for specific modification sites
Enrichment strategies for specific PTMs:
Metal oxide affinity chromatography for phosphorylation
Lectin affinity for glycosylation
Antibody-based enrichment for acetylation, methylation
Chemical labeling strategies for cysteine modifications
Site-directed mutagenesis validation:
Mutation of predicted modification sites to non-modifiable residues
Functional characterization of mutants
Comparative analysis of wild-type vs. mutant proteins
Expression system considerations:
Parallel analysis of protein expressed in different systems
Comparison of E. coli (minimal modifications) vs. mammalian (full modifications)
Use of inhibitors to block specific PTM pathways
These approaches should be tailored based on the specific PTMs suspected to occur on ycjF, which may include phosphorylation, glycosylation, and lipid modifications common to bacterial membrane proteins .
Given that ycjF remains functionally uncharacterized (UPF0283 family) , several complementary functional genomics approaches can be employed:
Genetic manipulation techniques:
CRISPR-Cas9 gene deletion or disruption with phenotypic characterization
Conditional knockdown systems (antisense RNA, CRISPRi)
Overexpression studies to identify gain-of-function phenotypes
Complementation studies with orthologs from other species
High-throughput phenotypic screening:
Biolog phenotype microarrays to identify growth conditions affected by ycjF deletion
Fitness profiling across diverse environmental conditions
Antibiotic susceptibility profiling
Stress response characterization (pH, temperature, osmotic shock)
Interaction studies:
Bacterial two-hybrid or split-ubiquitin membrane yeast two-hybrid
Co-immunoprecipitation coupled with mass spectrometry
Protein-lipid overlay assays
Crosslinking mass spectrometry for interaction partners
Transcriptomics and metabolomics:
RNA-seq comparing wild-type and ycjF mutant strains
ChIP-seq if DNA-binding activity is suspected
Untargeted metabolomics to identify affected metabolic pathways
Lipidomics to assess membrane composition changes
These approaches should be performed under multiple growth conditions, including those mimicking host infection environments, to capture condition-specific functions .
Evaluation of ycjF as a biomarker or vaccine candidate requires systematic assessment of several key parameters:
Immunogenicity assessment:
Epitope mapping using overlapping peptide arrays
B-cell epitope prediction and validation
T-cell epitope identification through MHC binding assays
Animal immunization studies with recombinant protein
Specificity and conservation analysis:
Bioinformatic analysis of sequence conservation across Salmonella strains
Cross-reactivity testing with antibodies against related bacterial species
Assessment of expression levels during different growth phases and infection stages
Analysis of accessibility on bacterial cell surface
Functional evaluation in infection models:
Mouse infection models with wild-type vs. ycjF-deficient strains
Adherence and invasion assays in relevant cell types
Serum bactericidal assays using anti-ycjF antibodies
Opsonophagocytosis assays
Vaccine formulation considerations:
Conjugation to carrier proteins (like CRM₁₉₇ used in other Salmonella vaccines)
Formulation with appropriate adjuvants
Stability testing under various storage conditions
Dosage optimization and administration route studies
Recent work on S. Paratyphi A O-antigen glycoconjugate vaccines shows the importance of evaluating protection against diverse clinical isolates, suggesting similar principles would apply to ycjF-based approaches .
Given the challenges of membrane protein structural determination, several cutting-edge approaches are particularly promising for ycjF:
The successful application of these techniques requires careful optimization of recombinant protein production conditions to ensure proper folding and stability, particularly when expressing in E. coli systems .
Mapping the protein-protein interaction (PPI) network of ycjF requires specialized approaches for membrane proteins:
In vivo crosslinking strategies:
Photo-amino acid incorporation at specific positions
Chemical crosslinking with membrane-permeable reagents
In vivo biotinylation using proximity labeling (BioID, APEX)
Time-resolved crosslinking to capture dynamic interactions
Membrane-specific interaction techniques:
Split-ubiquitin membrane yeast two-hybrid
MYTH (membrane yeast two-hybrid) system
mSPINE (membrane-based single protein interaction engineering)
FRET/BRET-based interaction screening
Affinity purification approaches:
Tandem affinity purification with membrane-specific solubilization
Co-immunoprecipitation with epitope-tagged ycjF
Pull-down assays with recombinant protein fragments
Quantitative proteomics comparing wild-type vs. ycjF-deficient strains
Validation and functional characterization:
Bimolecular fluorescence complementation (BiFC) in bacterial cells
Protein fragment complementation assays
Surface plasmon resonance for binding kinetics
Bacterial three-hybrid systems for complex formation analysis
The integration of these multiple approaches is necessary to overcome technical challenges associated with membrane protein interactions and to distinguish true interactors from nonspecific associations .