Recombinant Salmonella paratyphi A UPF0442 protein yjjB (yjjB)

Shipped with Ice Packs
In Stock

Description

Introduction to UPF0442 Protein YjjB

The UPF0442 protein YjjB, encoded by the yjjB gene in Salmonella Paratyphi A, is a conserved cytoplasmic protein of unknown precise function. Recombinant versions of this protein are produced in E. coli with His-tags for purification and research applications . Its role in bacterial physiology and potential as a vaccine component or diagnostic tool has driven interest in its recombinant form.

Key Features:

  • Species: Salmonella Paratyphi A (strains AKU_12601 and ATCC 9150) .

  • Expression System: E. coli with N-terminal His-tag .

  • Protein Length: Full-length (1–157 amino acids) .

  • Purity: >90% by SDS-PAGE .

Role in Vaccine Development

Recombinant YjjB is under investigation as a component of glycoconjugate vaccines. A bivalent vaccine combining S. Typhi and S. Paratyphi A O-antigens (O:2-CRM197_{197}) demonstrated:

  • Bactericidal Activity: Rabbit sera induced by O:2-CRM197_{197} showed broad bactericidal efficacy against diverse S. Paratyphi A clinical isolates, independent of O-antigen structural variations (e.g., O-acetylation levels) .

  • Adjuvant Compatibility: Adsorption to Alhydrogel did not reduce immunogenicity or functional antibody responses .

Preclinical and Clinical Progress

  • Phase 1 Trials: The O:2-CRM197_{197} conjugate completed a Phase 1 trial (NCT05613205), showing safety and immunogenicity in humans .

  • Animal Models: Immunization with recombinant YjjB-containing formulations protected 75–91.7% of mice against S. Paratyphi A challenge when co-administered with other antigens .

Table 2: Key Preclinical Results

Study ModelOutcomeCitation
RabbitsSera achieved IC50_{50} values ≤1:1,280 in bactericidal assays .
Mice75–91.7% survival post-immunization with multi-antigen formulations .

Future Directions

  • Clinical Validation: Ongoing studies aim to confirm YjjB’s efficacy in human trials .

  • Mechanistic Studies: Further research is needed to elucidate YjjB’s role in bacterial pathogenesis and immune evasion.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include any special requirements when placing your order and we will fulfill them to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize its inclusion in the development process.
Synonyms
yjjB; SPA4359; UPF0442 protein YjjB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
yjjB
Target Protein Sequence
MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIE WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links

KEGG: spt:SPA4359

Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant YjjB protein?

Recombinant YjjB can be expressed in multiple systems, with E. coli being the most commonly documented . The methodological approach typically includes:

  • Gene cloning into an expression vector with an N-terminal His-tag

  • Transformation into E. coli expression strains

  • Induction of expression (often with IPTG for T7-based systems)

  • Cell lysis under native or denaturing conditions

  • Affinity purification using Ni-NTA or similar matrices

  • Further purification via size exclusion or ion exchange chromatography

Alternative expression systems including yeast, baculovirus, and mammalian cells have been used , particularly when investigating post-translational modifications or when E. coli-expressed protein shows poor solubility or activity.

How is Salmonella paratyphi A classified in current genomic frameworks?

Salmonella paratyphi A, the source organism of YjjB protein, is a major cause of paratyphoid fever with an estimated 3.4 million infections annually worldwide . Recent advances in genomic classification have led to the development of "Paratype," a SNP-based genotyping scheme that segregates the global population of S. paratyphi A into:

  • 3 primary clades

  • 9 secondary clades

  • 18 distinct genotypes

This classification system replaces earlier lineage schemes that failed to capture the full genomic diversity of this pathogen. Researchers can utilize the Paratype tool (https://github.com/CHRF-Genomics/Paratype/) to accurately classify S. paratyphi A isolates using whole-genome sequencing data in various formats (fastq, bam, vcf, or fasta files) .

What methodologies are most effective for investigating potential intrinsic disorder in YjjB protein?

YjjB may contain intrinsically disordered regions (IDRs) that lack a fixed 3D structure under physiological conditions. To investigate this possibility, researchers should employ a multi-faceted approach:

  • Computational prediction:

    • Use specialized algorithms like PONDR, IUPred, or DisProt

    • Apply consensus approaches (metapredictors) such as MobiDB

  • Experimental validation:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Nuclear magnetic resonance (NMR) spectroscopy for structural flexibility

    • Small-angle X-ray scattering (SAXS) to analyze the protein's shape in solution

    • Limited proteolysis to identify exposed, flexible regions

  • Functional characterization:

    • Identify potential binding partners that might induce folding

    • Investigate post-translational modifications that could occur in disordered regions

This combinatorial approach is crucial as intrinsically disordered proteins (IDPs) often serve as hubs in protein-protein interaction networks and can adopt different conformations when interacting with various partners .

How might YjjB contribute to S. paratyphi A pathogenesis and host-pathogen interactions?

While the exact function of YjjB remains to be fully elucidated, several methodological approaches can help investigate its potential role in pathogenesis:

  • Genetic approaches:

    • Generate yjjB gene knockout mutants

    • Perform complementation studies

    • Utilize CRISPR-Cas9 for precise genome editing

  • Infection models:

    • Ex vivo cell culture infection assays

    • Cell invasion and intracellular survival assays

    • Organoid models to mimic intestinal environment

  • Proteomic analysis:

    • Identify YjjB interaction partners via co-immunoprecipitation

    • Perform pull-down assays with tagged recombinant protein

    • Use proximity labeling techniques (BioID, APEX) to identify transient interactions

  • Metabolomic profiling:

    • Compare metabolite profiles between wild-type and yjjB mutants

    • Investigate if YjjB influences the distinct metabolite signatures observed in patients with S. paratyphi A infections

These approaches would help determine if YjjB contributes to key virulence processes such as invasion, immune evasion, or metabolic adaptation within the host.

What are the optimal protocols for structural studies of YjjB protein?

Determining the structure of YjjB presents several challenges, particularly if it contains transmembrane domains or intrinsically disordered regions. A comprehensive structural biology approach includes:

  • Protein preparation:

    • Optimize buffer conditions to maintain stability

    • Test detergents for solubilization if membrane-associated

    • Consider fusion partners (e.g., MBP, SUMO) to enhance solubility

    • Remove flexible regions for crystallization attempts

  • Structural determination methods:

    • X-ray crystallography:

      • Sparse matrix screens for crystallization conditions

      • In situ proteolysis during crystallization

      • Surface entropy reduction

    • Cryo-electron microscopy for larger complexes

    • NMR spectroscopy for dynamic regions

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Computational approaches:

    • Homology modeling using related structures

    • Ab initio modeling for unique regions

    • Molecular dynamics simulations to study flexibility

This integrated approach maximizes the chances of obtaining structural information, particularly for challenging proteins like YjjB.

How can YjjB be utilized in diagnostic development for paratyphoid fever?

Current diagnostic limitations for paratyphoid fever create opportunities for novel approaches using proteins like YjjB:

  • Serological diagnostics:

    • Generate high-quality antibodies against recombinant YjjB

    • Develop ELISA-based assays for patient serum

    • Create lateral flow assays for point-of-care testing

  • Antigen detection methods:

    • Design aptamers specific to YjjB

    • Develop immunochromatographic tests

    • Create multiplexed assays that detect multiple S. paratyphi A proteins

  • Integration with metabolomic approaches:

    • Combine YjjB detection with metabolite biomarkers

    • Use the highly significant metabolite profiles distinguishing S. Typhi and S. Paratyphi A infections

    • Develop a combination of six metabolites with YjjB detection for improved accuracy

  • Genotyping integration:

    • Correlate YjjB variants with genotypes identified by Paratype

    • Design PCR-based assays targeting yjjB gene variants

    • Develop sequencing-based diagnostics for antimicrobial resistance prediction

These approaches could significantly improve the specificity and sensitivity of paratyphoid fever diagnosis, particularly in resource-limited settings.

What role might YjjB play in antimicrobial resistance, and how can this be investigated?

While direct evidence linking YjjB to antimicrobial resistance (AMR) is limited, several methodological approaches can explore this potential connection:

  • Comparative genomics:

    • Analyze yjjB sequence variations across resistant and susceptible strains

    • Correlate yjjB variants with the presence of AMR genes and mutations

    • Examine yjjB expression in different genotypes associated with QRDR mutations

  • Functional studies:

    • Overexpress or delete yjjB and assess changes in minimum inhibitory concentrations

    • Perform transposon mutagenesis to identify genetic interactions with known resistance genes

    • Use chemical genomics to identify compounds that specifically target YjjB

  • Structural approaches:

    • Investigate if YjjB interacts with antibiotics directly

    • Examine potential structural changes in YjjB in response to antibiotic exposure

    • Model interactions with cellular components known to be involved in resistance

The integration of these approaches could determine whether YjjB contributes to the increasing antimicrobial resistance observed in S. paratyphi A isolates, particularly the emergence of QRDR mutations since 1997 .

How can YjjB be leveraged in vaccine development against S. paratyphi A?

With no licensed vaccines currently available against S. paratyphi A , YjjB presents a potential target for vaccine development:

  • Antigen assessment:

    • Evaluate YjjB immunogenicity in animal models

    • Determine conservation across S. paratyphi A strains

    • Identify immunodominant epitopes using epitope mapping

  • Vaccine platform approaches:

    • Incorporate YjjB into subunit vaccine formulations

    • Test as a carrier protein for conjugate vaccines targeting O-antigens

    • Evaluate as a component in combination with other S. paratyphi A antigens

  • Delivery systems:

    • Explore lipid nanoparticle encapsulation

    • Test incorporation into virus-like particles

    • Evaluate mucosal delivery systems

  • Integration with existing vaccine efforts:

    • Consider combination with O:2-CRM197 conjugate vaccines

    • Explore bivalent formulations with typhoid conjugate vaccines

    • Investigate polyvalent approaches targeting multiple enteric pathogens

These approaches could contribute to the development of effective vaccines against paratyphoid fever, particularly in regions with high disease burden.

What bioinformatic tools and resources are most valuable for YjjB research?

Researchers working with YjjB can leverage numerous computational resources:

  • Sequence analysis tools:

    • Sequence alignments with homologs (BLAST, HMMER)

    • Evolutionary analysis (MEGA, PhyML)

    • Protein family classification (Pfam, InterPro)

  • Structural prediction resources:

    • AlphaFold2 for ab initio structure prediction

    • SWISS-MODEL for homology modeling

    • PredictProtein for functional sites

    • TMHMM or TOPCONS for transmembrane region prediction

  • Genomic context analysis:

    • Paratype for S. paratyphi A genotyping

    • Prokaryotic operon predictors

    • Synteny analysis across related species

  • Functional prediction:

    • Gene Ontology enrichment analysis

    • Protein-protein interaction network analysis

    • Metabolic pathway mapping

These computational approaches complement experimental studies and can generate hypotheses about YjjB function, particularly given its current classification as a hypothetical protein in some databases .

What are the methodological considerations for studying YjjB protein localization within S. paratyphi A?

Understanding the subcellular localization of YjjB is crucial for functional characterization:

  • Computational prediction:

    • Use specialized algorithms for prokaryotic protein localization

    • Analyze signal sequences and sorting motifs

    • Predict transmembrane domains and membrane association

  • Fluorescence microscopy approaches:

    • Create fluorescent protein fusions (GFP, mCherry)

    • Perform live cell imaging in S. paratyphi A

    • Conduct time-lapse microscopy during infection

  • Biochemical fractionation:

    • Separate cellular compartments (cytosol, membrane, periplasm)

    • Perform Western blot analysis of fractions

    • Use density gradient centrifugation for finer separation

  • Immunolocalization methods:

    • Generate specific antibodies against YjjB

    • Perform immunogold electron microscopy

    • Use super-resolution microscopy techniques

  • Proteomics approaches:

    • Analyze enriched membrane proteome

    • Perform proximity labeling experiments

    • Use chemical cross-linking mass spectrometry

These complementary approaches would provide comprehensive insights into where YjjB functions within the bacterial cell, informing hypotheses about its role in bacterial physiology and pathogenesis.

What are the recommended storage and handling protocols for recombinant YjjB protein?

Based on available information, optimal handling of recombinant YjjB includes:

ParameterRecommendationRationale
Storage FormLyophilized powderEnhances stability and extends shelf life
Storage Temperature-20°C to -80°C for stockPrevents degradation and maintains activity
Working Storage4°C for up to one weekAvoids repeated freeze-thaw cycles
Buffer CompositionTris/PBS-based, pH 8.0 with 6% TrehaloseStabilizes protein structure
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLEnsures proper solubilization
Long-term StorageAdd glycerol to 50% final concentrationPrevents freeze damage
Freeze-thawAvoid repeated cyclesMaintains structural integrity

Additionally, researchers should aliquot the reconstituted protein to avoid repeated freeze-thaw cycles and consider adding protease inhibitors if degradation is observed during experimental manipulations.

How can researchers verify the functional integrity of recombinant YjjB?

Without established functional assays for YjjB, researchers must employ multiple approaches to verify protein integrity:

  • Physical characterization:

    • Size exclusion chromatography to confirm monodispersity

    • Dynamic light scattering to assess aggregation state

    • Thermal shift assays to evaluate stability

    • Circular dichroism to verify secondary structure elements

  • Biochemical verification:

    • Mass spectrometry to confirm identity and detect modifications

    • Limited proteolysis to assess proper folding

    • Antibody recognition using conformational antibodies

    • Ligand binding assays if binding partners are identified

  • Activity assessment:

    • Develop binding assays with predicted interaction partners

    • Investigate membrane association properties

    • Test putative enzymatic activities based on structural predictions

    • Assess functional complementation in knockout strains

These approaches collectively provide confidence in the structural and functional integrity of recombinant YjjB preparations for downstream experiments.

How might studying YjjB contribute to understanding the evolution of Salmonella Paratyphi A?

YjjB variants could provide insights into the evolutionary history of S. paratyphi A:

  • Comparative genomic analysis:

    • Analyze yjjB sequence conservation across the 18 genotypes identified by Paratype

    • Compare with orthologs in other Salmonella serovars

    • Identify selection pressures through dN/dS analysis

  • Phylogenetic approaches:

    • Construct gene trees based on yjjB sequences

    • Compare with whole-genome phylogenies

    • Identify potential horizontal gene transfer events

  • Population genetics:

    • Analyze yjjB allele frequencies across geographic regions

    • Correlate with antimicrobial resistance patterns

    • Identify signatures of selection

  • Experimental evolution:

    • Track yjjB mutations during laboratory evolution experiments

    • Test fitness effects of specific variants

    • Examine host adaptation through passage experiments

These approaches would contribute to understanding how S. paratyphi A has evolved over time, particularly in response to selective pressures like host immunity and antibiotic use.

What are the challenges in developing high-throughput screening assays targeting YjjB?

Developing functional assays for YjjB presents several challenges:

  • Uncertain function:

    • Design assays based on predicted functions

    • Develop multiple parallel screening approaches

    • Use phenotypic readouts in knockout strains

  • Membrane association:

    • Optimize detergent conditions for solubility

    • Consider native membrane environments

    • Develop cell-based assays preserving membrane context

  • Assay development strategies:

    • Thermal shift assays for ligand binding

    • Surface plasmon resonance for interaction screening

    • Bacterial two-hybrid systems for protein interaction partners

    • Growth inhibition assays in YjjB-dependent conditions

  • Validation approaches:

    • Secondary orthogonal assays

    • Structure-activity relationship studies

    • Target engagement verification in bacterial cells

These methodological considerations would enable the development of robust screening assays for identifying compounds or biologics targeting YjjB.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.