Recombinant Salmonella paratyphi A Virulence sensor histidine kinase PhoQ (phoQ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
phoQ; SPA1620; Virulence sensor histidine kinase PhoQ; Sensor histidine protein kinase/phosphatase PhoQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-487
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
phoQ
Target Protein Sequence
MNKFARHFLPLSLRVRFLLATAGVVLVLSLAYGIVALVGYSVSFDKTTFRLLRGESNLFY TLAKWENNKISVELPENLDMQSPTMTLIYDETGKLLWTQRNIPWLIKSIQPEWLKTNGFH EIETNVDATSTLLSEDHSAQEKLKEVREDDDDAEMTHSVAVNIYPATARMPQLTIVVVDT IPIELKRSYMVWSWFVYVLAANLLLVIPLLWIAAWWSLRPIEALAREVRELEDHHREMLN PETTRELTSLVRNLNQLLKSERERYNKYRTTLTDLTHSLKTPLAVLQSTLRSLRNEKMSV SKAEPVMLEQISRISQQIGYYLHRASMRGSGVLLSRELHPVAPLLDNLISALNKVYQRKG VNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDDHLHIFVEDDGPG IPHSKRSLVFDRGQRADTLRPGQGVGLAVAREITEQYAGQIIASDSLLGGARMEVVFGRQ HPTQKEE
Uniprot No.

Target Background

Function

PhoQ is a member of the two-component regulatory system PhoP/PhoQ in Salmonella paratyphi A. This system regulates genes involved in virulence and resistance to antimicrobial peptides produced by the host. Under conditions of low periplasmic Mg2+, PhoQ functions as a membrane-associated histidine kinase, undergoing autophosphorylation and subsequently transferring the phosphate group to PhoP. This phosphorylation activates the expression of PhoP-activated genes (PAGs) and represses PhoP-repressed genes (PRGs). Conversely, under high periplasmic Mg2+ concentrations, PhoQ acts as a phosphatase, dephosphorylating phospho-PhoP. This dephosphorylation represses PAG expression and may lead to the expression of some PRGs.

Database Links

KEGG: spt:SPA1620

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the PhoP/PhoQ system contribute to Salmonella virulence?

The PhoP/PhoQ two-component system in Salmonella contributes to virulence by coordinating adaptation to low concentrations of environmental Mg2+. When extracellular Mg2+ is limited, the system activates a phosphorylation cascade that modulates the transcription of PhoP-regulated genes. Conversely, high concentrations of extracellular Mg2+ stimulate the dephosphorylation of PhoP by PhoQ .

This system regulates multiple virulence factors, including genes involved in:

  • Lipopolysaccharide (LPS) modifications

  • Antimicrobial peptide resistance

  • Iron uptake and storage

  • Type III secretion systems encoded by Salmonella pathogenicity islands (SPI-1 and SPI-2)

Research has demonstrated that phoPQ-deleted strains exhibit increased sensitivity to deoxycholate and polymyxin B compared to their parent strains, confirming their role in antimicrobial resistance .

What are the optimal conditions for expressing recombinant PhoQ from S. paratyphi A?

For optimal expression of recombinant PhoQ from S. paratyphi A:

  • Expression System: E. coli is the preferred expression system, as demonstrated in multiple studies .

  • Purification Strategy:

    • Use a His-tag for affinity purification (typically N-terminal)

    • Purify using metal affinity chromatography

    • Store in Tris-based buffer with 50% glycerol at -20°C or -80°C

  • Reconstitution Protocol:

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (optimal: 50%)

    • Aliquot for long-term storage at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

How can functional activity of recombinant PhoQ be assessed in vitro?

Functional activity of recombinant PhoQ can be assessed through several biochemical assays:

  • Autokinase Activity Assay:

    • Reconstitute purified PhoQ into E. coli liposomes

    • Incubate with Mg2+-ATP

    • Detect phosphorylated PhoQ via radioactive labeling or phospho-specific antibodies

  • Phosphotransfer Assay:

    • Measure transfer of the phosphoryl group from reconstituted PhoQ to PhoP

    • Analyze phosphorylation states using gel electrophoresis

  • Phosphatase Activity Assay:

    • Monitor dephosphorylation of phospho-PhoP by reconstituted PhoQ

    • This activity is stimulated by the addition of extraluminal ADP

  • Liposome Reconstitution Method:

    • Insert purified PhoQ(His) into liposomes in a unidirectional orientation

    • Position the sensory domain facing the lumen

    • Ensure the catalytic domain faces the extraluminal environment

These assays collectively confirm the bi-functional nature of PhoQ as both a kinase and phosphatase in response to environmental signals.

How has PhoQ deletion been utilized in vaccine development against S. paratyphi A?

The deletion of phoPQ (along with other virulence genes) has been strategically utilized in the development of attenuated live vaccines against S. paratyphi A:

  • Attenuation Strategy:

    • Combined deletion of phoPQ with other virulence loci such as htrA

    • Integration of Vi capsular polysaccharide genes into attenuated strains

  • Research Example:
    Roland et al. (2010) constructed four phoPQ-deleted strains from different parent strains of S. paratyphi A. The mutant MGN10028 was well-tolerated at all administered doses and immunogenic following single oral inoculation in an oral rabbit model. Immunization induced immune responses that protected animals against clinical manifestations following S. paratyphi A challenge .

  • Bivalent Vaccine Approach:
    One notable strategy integrated the viaB locus (containing 10 genes responsible for Vi biosynthesis) from S. Typhi into the chromosome of S. paratyphi A, followed by deletion of htrA and phoPQ to create a bivalent vaccine candidate (named SPA-VPH). This approach demonstrated:

    • Stable maintenance of the viaB locus in the chromosome

    • Production of Vi polysaccharide over 200+ passages

    • Induction of high levels of Vi-specific and S. paratyphi A-specific antibodies

    • Significant protection against wild-type challenge of both S. paratyphi A and S. Typhi

What research methods can distinguish between the effects of PhoQ mutation versus other virulence gene mutations?

To distinguish between effects of PhoQ mutation versus other virulence gene mutations, researchers can employ:

  • Complementation Studies:

    • Reintroduce functional PhoQ gene in trans to confirm phenotype restoration

    • Use a plasmid-based complementation system with inducible promoters

    • Compare complemented strain with mutant and wild-type to confirm PhoQ-specific effects

  • Transcriptomic Analysis:

    • Compare gene expression profiles of phoQ mutants with other virulence gene mutants

    • Identify PhoQ-specific regulons using RNA-Seq or microarray analysis

    • Distinguish direct regulatory effects from indirect consequences of virulence attenuation

  • Comparative in vivo Models:

    • Analyze organ colonization patterns of different mutants

    • As demonstrated in mouse models, phoPQ-deleted strains show characteristic clearance patterns distinguishable from other virulence mutants

    • Data indicates phoPQ mutants are cleared from spleen, liver, and mesenteric lymph nodes approximately 7 days post-infection

  • Biochemical Stress Response Assays:

    • Test sensitivity to specific antimicrobial peptides

    • Assess resistance to environmental stressors (pH, oxidative stress)

    • PhoQ mutants specifically show increased sensitivity to deoxycholate and polymyxin B

What are the common challenges in working with recombinant PhoQ protein and how can they be addressed?

Working with recombinant PhoQ presents several technical challenges:

  • Protein Stability Issues:

    • Challenge: PhoQ tends to aggregate during purification and storage

    • Solution: Add 50% glycerol to storage buffer; maintain at -20°C/-80°C; work with small aliquots to avoid repeated freeze-thaw cycles

  • Functional Reconstitution:

    • Challenge: Maintaining proper orientation and activity in artificial membrane systems

    • Solution: Use E. coli liposomes with controlled protein insertion; verify orientation through protease accessibility assays; ensure the sensory domain faces the lumen and the catalytic domain faces the extraluminal environment

  • Activity Assessment:

    • Challenge: Distinguishing between autokinase, phosphotransfer, and phosphatase activities

    • Solution: Perform sequential reactions with purified components; use ADP to specifically stimulate phosphatase activity; control Mg2+ concentrations to modulate kinase/phosphatase balance

  • Expression Yield:

    • Challenge: Low expression levels in heterologous systems

    • Solution: Optimize codon usage for E. coli expression; use strong inducible promoters; consider fusion partners to increase solubility; attempt expression at lower temperatures (16-18°C)

How can researchers effectively analyze the interaction between PhoQ and its response regulator PhoP?

To effectively analyze PhoQ-PhoP interactions:

  • In vitro Reconstitution Systems:

    • Reconstitute PhoQ into liposomes in controlled orientation

    • Add purified PhoP to the system

    • Monitor phosphoryl transfer between components using radioactive ATP or phospho-specific detection methods

  • Surface Plasmon Resonance (SPR):

    • Immobilize one component (typically PhoP) on a sensor chip

    • Flow the partner protein (PhoQ) over the surface

    • Measure binding kinetics and affinity constants

    • Compare wild-type interactions with mutant variants

  • Bacterial Two-Hybrid Systems:

    • Generate fusion constructs of PhoQ and PhoP with split reporter proteins

    • Quantify interaction strength through reporter activity

    • Test effects of mutations on interaction efficiency

  • FRET-Based Approaches:

    • Tag PhoQ and PhoP with appropriate fluorophore pairs

    • Monitor real-time interactions in reconstituted systems

    • Assess conformational changes during signal transduction

How do recent genomic surveillance tools help track S. paratyphi A variants with different PhoQ sequences?

Recent genomic surveillance tools have revolutionized tracking of S. paratyphi A variants with different PhoQ sequences:

  • Paratype Genotyping Tool:
    The recently developed SNP-based genotyping scheme, Paratype, segregates S. paratyphi A population into:

    • Three primary clades

    • Nine secondary clades

    • 18 distinct genotypes

    This tool enables tracking of spatiotemporal genomic variation and antimicrobial resistance markers across global S. paratyphi A populations. The database represents 37 countries with samples from 1917-2019 .

  • Methodology Applications:

    • Works with both Illumina and Nanopore raw read files

    • Each genotype is assigned a unique allele definition located on an essential gene

    • Enables global monitoring of S. paratyphi A evolution, including PhoQ sequence variations

  • Research Implications:

    • Facilitates correlation between PhoQ sequence variants and virulence phenotypes

    • Enables tracking of antimicrobial resistance spread

    • Supports vaccine design by identifying conserved and variable regions

What are the latest experimental approaches to study PhoQ signal transduction mechanisms?

Cutting-edge approaches to study PhoQ signal transduction include:

  • Cryo-EM Structural Analysis:

    • Captures conformational changes in PhoQ upon signal recognition

    • Provides insights into transmembrane signal transduction mechanisms

    • Reveals details of PhoQ-PhoP interaction interfaces at molecular resolution

  • Advanced Reconstitution Systems:

    • Nanodiscs containing single PhoQ molecules for single-molecule studies

    • Microfluidic systems with controlled ion gradients to mimic in vivo conditions

    • Biosensors to detect real-time phosphorylation events

  • Functional Domain Mapping Using CRISPR-Cas9:

    • Precise genome editing to create domain-specific mutations

    • Analysis of signal recognition versus transmission functions

    • Screening of large mutant libraries for phenotypic consequences

  • Quantitative Phosphoproteomics:

    • Global analysis of phosphorylation cascades downstream of PhoQ activation

    • Temporal mapping of signaling events following environmental stimuli

    • Cross-talk identification between PhoP/PhoQ and other signaling systems

How does PhoQ from S. paratyphi A compare with homologs from other Salmonella serovars?

PhoQ from S. paratyphi A shows both similarities and differences when compared to homologs from other Salmonella serovars:

FeatureS. paratyphi A PhoQS. typhimurium PhoQS. typhi PhoQ
Protein Length487 amino acids487 amino acids487 amino acids
Domain OrganizationPeriplasmic sensor, transmembrane, catalyticSameSame
Mg2+ SensingYes, critical for functionYes, well-characterizedYes, similar mechanism
Signal TransductionResponds to environmental Mg2+Similar mechanismSimilar mechanism
Virulence RoleCritical for pathogenesisWell-established roleCritical for typhoid pathogenesis
Genetic ContextSPA1620 locusSimilar genomic organizationSimilar genomic organization
Deletion EffectsAttenuated virulence, vaccine potentialAttenuated virulenceAttenuated virulence

While the core function and structure are conserved across serovars, subtle sequence variations may contribute to host specificity and virulence differences. Research using purified PhoQ proteins from different serovars has shown essentially similar biochemical activities, including autokinase activity, phosphotransfer to PhoP, and phosphatase activity .

What experimental protocols exist to compare wild-type versus mutant PhoQ protein functions?

Several experimental protocols can effectively compare wild-type versus mutant PhoQ functions:

  • In vitro Enzymatic Assays:

    • Autokinase activity measurement using purified proteins

    • Phosphotransfer efficiency to PhoP

    • Phosphatase activity under different Mg2+ concentrations

    • Effects of ADP on dephosphorylation kinetics

  • Cell-Based Reporter Systems:

    • PhoP-regulated promoter-reporter constructs

    • Measurement of transcriptional output in response to environmental signals

    • Complementation of phoQ-deleted strains with wild-type or mutant variants

  • In vivo Virulence Assessment:

    • Mouse infection models comparing organ colonization

    • Competitive index experiments between wild-type and mutant strains

    • Survival and clearance kinetics

    Data from such experiments show that phoPQ mutants are significantly attenuated, with bacterial counts in spleen, MLN, and liver reduced by 100-1000 fold compared to wild-type strains by day 4 post-infection, with complete clearance by day 7 .

  • Structural Biology Approaches:

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational differences

    • Limited proteolysis to detect structural alterations

    • Thermal shift assays to measure protein stability changes

What are promising research directions for developing new attenuated vaccines based on PhoQ modifications?

Promising research directions for PhoQ-based vaccine development include:

  • Precision Engineering of PhoQ:

    • Site-directed mutagenesis to create partially functional PhoQ variants

    • Design of PhoQ proteins with controlled signaling properties

    • Development of strains with tunable attenuation levels for optimal balance between safety and immunogenicity

  • Multivalent Vaccine Approaches:

    • Combination of phoPQ deletion with other attenuating mutations (htrA, guaBA, clpX)

    • Integration of heterologous antigens into attenuated backgrounds

    • Development of bivalent vaccines protective against multiple Salmonella serovars

  • Controlled Expression Systems:

    • In vivo inducible promoters controlling PhoQ expression

    • Design of synthetic regulatory circuits for controlled attenuation

    • Development of strains with timed self-destruction mechanisms

  • Optimized Delivery Platforms:

    • Encapsulation technologies for oral delivery of attenuated strains

    • Mucosal adjuvant co-delivery to enhance immune responses

    • Prime-boost strategies combining attenuated strains with subunit vaccines

How might advanced structural biology techniques provide new insights into PhoQ function?

Advanced structural biology techniques could revolutionize our understanding of PhoQ function:

  • Cryo-Electron Microscopy (Cryo-EM):

    • High-resolution structures of full-length PhoQ in different activation states

    • Visualization of conformational changes during signal transduction

    • Structural basis of PhoQ-PhoP interactions

  • Molecular Dynamics Simulations:

    • Simulation of PhoQ dynamics in membrane environments

    • Prediction of ion binding sites and conformational changes

    • Modeling of signal transmission through transmembrane domains

  • Single-Molecule FRET:

    • Real-time observation of conformational changes in individual PhoQ molecules

    • Detection of intermediate states during activation

    • Kinetic analysis of conformational transitions

  • In-Cell NMR:

    • Study of PhoQ structure and dynamics in native cellular environments

    • Detection of interaction partners in vivo

    • Monitoring of phosphorylation events in real-time

These advanced techniques could help resolve key questions about how environmental signals trigger structural changes in PhoQ, how these changes are transmitted across the membrane, and how they ultimately modulate interaction with and phosphorylation of PhoP.

What are the most significant unresolved questions about PhoQ function in S. paratyphi A?

Despite extensive research, several significant questions about PhoQ function in S. paratyphi A remain unresolved:

  • The precise molecular mechanism of Mg2+ sensing and how it triggers conformational changes in the protein

  • The complete regulon controlled by PhoP/PhoQ in S. paratyphi A and how it differs from other Salmonella serovars

  • The potential crosstalk between PhoP/PhoQ and other two-component systems during infection

  • The role of PhoQ in host-specific adaptation and virulence of S. paratyphi A

  • The optimal level of attenuation for vaccine development that balances safety and immunogenicity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.