Recombinant Salmonella paratyphi A Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us for preferential development.
Synonyms
zntB; SSPA1139; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWLLDGRGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTP LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTR QRKVLALDDVVSDLQEGTGPVDCGGWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWR FGFSLFCILLVVLIGGVTLWLHRSKWL
Uniprot No.

Target Background

Function
Mediates zinc ion efflux.
Database Links

KEGG: sek:SSPA1139

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ZntB and what is its primary function in Salmonella Paratyphi A?

ZntB (zinc transport protein B) is a transmembrane protein that functions in zinc efflux in Salmonella species, including S. Paratyphi A. It belongs to the cation diffusion facilitator (CDF) family and plays a crucial role in maintaining zinc homeostasis by exporting excess zinc from the bacterial cell. This function is critical since zinc, while essential for bacterial metabolism, can be toxic at high concentrations. In S. Paratyphi A, ZntB consists of approximately 327 amino acids forming a functional transport channel across the bacterial membrane. The protein's structure includes multiple transmembrane domains that create a pathway for zinc ions to exit the cell, helping the bacterium survive in various environmental conditions during infection .

How does ZntB in S. Paratyphi A differ structurally from ZntB in S. Paratyphi B and other Salmonella serovars?

The ZntB protein shows considerable sequence conservation across Salmonella serovars, but with notable differences. S. Paratyphi B ZntB consists of 327 amino acids with specific sequence characteristics that may influence its functionality. The full amino acid sequence from S. Paratyphi B includes regions of hydrophobic transmembrane domains interspersed with hydrophilic regions . While the core functional domains remain largely conserved across serovars, variations in specific amino acid residues may influence substrate specificity, transport efficiency, and regulatory mechanisms. These differences could contribute to serovar-specific adaptations in zinc homeostasis, potentially impacting pathogenicity profiles observed between S. Paratyphi A and other serovars such as S. Paratyphi B and S. Typhi .

What is the significance of zinc transport in S. Paratyphi A virulence and host-pathogen interactions?

Zinc homeostasis plays a critical role in S. Paratyphi A virulence, with ZntB functioning as a key regulator in this process. During infection, S. Paratyphi A encounters varying zinc concentrations in different host environments. At infection sites, host cells may attempt to restrict bacterial growth through nutritional immunity (limiting essential metals) or, conversely, may release excess zinc as an antimicrobial strategy. The ZntB protein helps the bacterium adapt to these changing conditions by exporting excess zinc.

Unlike S. Typhi, which possesses the Vi capsule with anti-inflammatory properties, S. Paratyphi A lacks this capsule and may induce different inflammatory responses in the host . This difference leads to varying metabolite profiles between infections caused by these serovars, including differential levels of ethanolamine, which is released by host tissue during inflammation. Studies have shown that ethanolamine is found in significantly higher concentrations in plasma from S. Paratyphi A patients compared to S. Typhi patients, suggesting differences in inflammatory processes that may be influenced by metal homeostasis systems including zinc transport mechanisms .

What are the recommended methods for expressing and purifying recombinant S. Paratyphi A ZntB for structural and functional studies?

For optimal expression and purification of recombinant S. Paratyphi A ZntB, a methodological approach similar to that used for S. Paratyphi B ZntB can be employed with appropriate modifications:

  • Expression System Selection: E. coli is the preferred heterologous expression system, particularly BL21(DE3) or similar strains optimized for membrane protein expression .

  • Vector Design:

    • Insert the full-length zntB gene (nucleotides encoding all 327 amino acids) into an expression vector with an N-terminal His-tag for purification

    • Include a protease cleavage site if tag removal is required for functional studies

    • Consider codon optimization for E. coli if expression levels are suboptimal

  • Expression Conditions:

    ParameterRecommended ConditionRationale
    Temperature18-25°CReduces inclusion body formation
    Inducer concentration0.1-0.5 mM IPTGBalances expression level and protein folding
    Duration12-16 hoursAllows sufficient protein accumulation
    MediaTB or auto-inductionSupports high-density culture growth
  • Membrane Extraction: Use a detergent-based approach with a buffer containing 20 mM Tris-HCl (pH 8.0), 300 mM NaCl, and appropriate detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG).

  • Purification Strategy:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Size exclusion chromatography for further purification and buffer exchange

    • Consider ion exchange chromatography as an additional step if higher purity is required

  • Storage: For maximum stability, maintain purified protein in buffer containing 20 mM Tris-HCl (pH 8.0), 150 mM NaCl, 6% trehalose, and appropriate detergent at concentrations above the critical micelle concentration .

Crucial quality control measures include SDS-PAGE analysis, mass spectrometry verification, and functional assays to confirm zinc transport activity of the purified protein.

How can researchers effectively design zinc transport assays to evaluate ZntB function in S. Paratyphi A?

Researchers can employ several complementary approaches to evaluate ZntB function:

  • In vitro Transport Assays:

    • Fluorescent Zinc Indicators: Use zinc-sensitive fluorophores like FluoZin-3 to measure zinc movement in proteoliposomes containing reconstituted ZntB

    • Radioactive 65Zn Uptake/Efflux: Measure movement of radiolabeled zinc across membranes containing ZntB

    • ICP-MS Quantification: Use inductively coupled plasma mass spectrometry to precisely quantify zinc concentrations in different compartments

  • Genetic Complementation Studies:

    • Create ZntB knockout strains of S. Paratyphi A

    • Complement with wild-type or mutant ZntB variants

    • Assess growth under varying zinc concentrations

  • Electrophysiological Approaches:

    • Reconstitute ZntB in planar lipid bilayers or patch-clamp systems

    • Measure zinc-dependent currents across membranes

  • Experimental Design Considerations:

    VariableRecommended RangeRationale
    Zinc concentration0.1-500 μMCovers physiological to toxic ranges
    pH5.5-8.0Mimics various host environments
    Competing cationsMg2+, Ca2+, Fe2+Tests transport specificity
  • Controls:

    • Include inactive ZntB mutants (e.g., site-directed mutagenesis of key residues)

    • Test transport in the presence of zinc chelators

    • Compare with other known zinc transporters

A comprehensive approach combining these methods allows researchers to fully characterize the transport kinetics, specificity, and regulation of ZntB function in S. Paratyphi A.

What experimental challenges are common when working with recombinant ZntB and how can they be addressed?

Working with recombinant ZntB presents several technical challenges:

  • Protein Aggregation and Instability:

    • Challenge: ZntB is prone to aggregation due to its hydrophobic transmembrane domains

    • Solution: Add glycerol (10-20%) and trehalose (6%) to storage buffers; avoid repeated freeze-thaw cycles by storing working aliquots at 4°C for short-term use and maintaining long-term stocks at -80°C

  • Low Expression Yields:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solution: Use specialized expression strains (C41/C43), optimize codon usage, and consider fusion partners like MBP that enhance folding and solubility

  • Functional Reconstitution:

    • Challenge: Maintaining transport activity after purification

    • Solution: Screen multiple detergent and lipid combinations for reconstitution; monitor protein orientation in liposomes

  • Assay Interference:

    • Challenge: Metal contaminants can interfere with zinc transport assays

    • Solution: Use metal-free buffers prepared with ultrapure water and plastic labware; pretreat solutions with Chelex-100 resin to remove trace metals

  • Structure-Function Analysis Complexities:

    • Challenge: Connecting structural features to transport mechanics

    • Solution: Combine site-directed mutagenesis with transport assays and structural methods (cryo-EM or X-ray crystallography)

A systematic approach to method optimization using design of experiments (DoE) can efficiently address these challenges while minimizing material consumption.

How does ZntB function differ between in vitro systems and during actual host infection with S. Paratyphi A?

ZntB functionality exhibits significant differences between controlled in vitro conditions and the complex host environment:

  • Regulatory Context:

    • In vitro: Expression and activity are primarily dependent on zinc concentration in isolation

    • In vivo: Regulation is integrated within complex networks responding to multiple host factors, including inflammatory signals and nutritional immunity mechanisms

  • Metal Availability:

    • In vitro: Defined, constant zinc concentrations

    • In vivo: Dynamic zinc concentrations that change throughout infection phases and across tissue compartments

  • Interaction with Host Factors:

    • Research has demonstrated that S. Paratyphi A infection induces distinct metabolite profiles compared to S. Typhi, suggesting differential host-pathogen interactions

    • The absence of the Vi capsule in S. Paratyphi A (present in S. Typhi) leads to distinct inflammatory responses that may influence zinc homeostasis and, consequently, ZntB function

    • Higher ethanolamine levels detected in S. Paratyphi A infections suggest different inflammatory environments that could affect metal ion availability and transport requirements

  • Functional Relevance:

    • In vitro: Function assessed primarily through direct transport measurements

    • In vivo: Contribution to survival, replication, and virulence must be evaluated within infection models

To bridge this gap, researchers should consider using cellular infection models and controlled human infection models (CHIMs) that more closely approximate physiological conditions, while monitoring zinc dynamics and transporter expression throughout the infection process .

What is the current understanding of how ZntB contributes to S. Paratyphi A pathogenesis compared to other Salmonella serovars?

ZntB's contribution to S. Paratyphi A pathogenesis involves complex interactions with host immunity and bacterial physiology:

  • Serovar-Specific Virulence Mechanisms:

    • S. Paratyphi A lacks the Vi capsule found in S. Typhi, which impacts inflammatory responses and potentially alters zinc homeostasis requirements during infection

    • These differences affect metabolite profiles during infection, with distinct patterns of saccharides and ethanolamine levels between serovars

  • Host Response Differences:

    • Challenge-rechallenge studies show that prior exposure to S. Paratyphi A provides partial protection against homologous infection but not against S. Typhi (heterologous protection)

    • The attack rate in participants with previous S. Paratyphi A exposure was 25% compared to 56% in naïve controls when rechallenged with S. Paratyphi A

    • This serovar-specific immunity suggests differences in antigen presentation and immune response that may be partly influenced by metal homeostasis systems

  • Comparative Virulence Contribution:

    SerovarZntB Role in VirulenceKey Distinguishing Factors
    S. Paratyphi ACritical for zinc efflux during host inflammatory responseLacks Vi capsule; induces stronger inflammatory response
    S. TyphiModerate contribution to zinc homeostasisVi capsule provides additional protection against zinc toxicity
    S. Paratyphi BSimilar to S. Paratyphi A but with serovar-specific adaptationsIntermediate inflammatory response
  • Infection Dynamics:

    • S. Paratyphi A enters human tissue with limited intestinal replication and potentially suppresses gastrointestinal inflammation differently than S. Typhi

    • ZntB may play a critical role in managing zinc stress encountered during this distinct infection trajectory

Understanding these differences is crucial for developing targeted interventions against specific Salmonella serovars and explains the lack of cross-protection observed in challenge-rechallenge studies .

How can structural information about ZntB be utilized to develop inhibitors as potential therapeutic agents against S. Paratyphi A?

Structural insights into ZntB provide valuable opportunities for rational drug design:

  • Structure-Based Drug Design Approach:

    • Utilize the protein sequence information (327 amino acids) to generate homology models of S. Paratyphi A ZntB based on known structures of related transporters

    • Identify potential binding pockets, particularly within the transmembrane domains and at metal binding sites

    • Apply molecular dynamics simulations to understand conformational changes during transport cycle

  • Target Site Selection:

    • Active Transport Site: Design chelator-mimetics that bind the zinc-binding pocket but cannot be transported

    • Gating Mechanism: Target residues involved in conformational changes required for transport

    • Allosteric Sites: Identify regulatory binding pockets that could lock the transporter in inactive conformations

  • Screening Approaches:

    • Virtual screening using docking algorithms against the identified binding sites

    • Fragment-based drug discovery to identify initial chemical scaffolds

    • High-throughput transport inhibition assays using fluorescent zinc indicators

  • Candidate Development Pipeline:

    Development StageKey ActivitiesSuccess Metrics
    Initial screeningIn silico and in vitro binding assaysBinding affinity (Kd < 10 μM)
    Lead validationTransport inhibition in proteoliposomesIC50 < 1 μM
    Cellular evaluationGrowth inhibition in zinc-limited conditionsMIC < 10 μg/mL
    Infection modelsEfficacy in cellular and animal infection modelsReduction in bacterial load
  • Selectivity Considerations:

    • Design compounds that exploit structural differences between bacterial ZntB and human zinc transporters

    • Focus on bacterial-specific structural motifs absent in mammalian transporters

This rational approach, combined with structure-activity relationship studies, can yield selective ZntB inhibitors that could potentially be developed into novel therapeutics against S. Paratyphi A infections.

How does research on ZntB integrate with broader investigations of S. Paratyphi A metabolism and host response during enteric fever?

ZntB research provides important insights into S. Paratyphi A pathogenesis within the broader context of enteric fever:

  • Metabolomic Connections:

    • Studies have identified distinct metabolite profiles in patients with S. Paratyphi A infections compared to S. Typhi infections

    • These metabolite differences reflect variations in bacterial metabolism and host response that may be influenced by zinc-dependent enzymes regulated by ZntB activity

    • Gas chromatography with time-of-flight mass spectrometry (GCxGC/TOFMS) has identified 695 individual metabolite peaks that distinguish between these infections

  • Host Response Integration:

    • Zinc plays a dual role in host-pathogen interactions during infection:

      • Component of nutritional immunity (host restricts zinc)

      • Toxic at high concentrations (host may release zinc as an antimicrobial strategy)

    • ZntB helps S. Paratyphi A navigate these zinc fluctuations during infection

    • The elevated ethanolamine levels in S. Paratyphi A infections suggest different inflammatory environments that likely affect zinc availability

  • Systemic Disease Progression:

    • Unlike localized gastrointestinal infections caused by other Salmonella, S. Paratyphi A causes systemic infection

    • ZntB's role may vary across different host compartments encountered during systemic spread

    • Challenge-rechallenge studies show that prior exposure provides partial but incomplete protection against subsequent infection

  • Research Integration Framework:

    Research AreaConnection to ZntBMethodological Approach
    MetabolomicsZinc-dependent metabolic pathwaysGCxGC/TOFMS, targeted metabolite analysis
    ImmunologyMetal-dependent immune responsesCytokine profiling, immune cell responses to zinc flux
    Bacterial physiologyAdaptation to host environmentsTranscriptomics during infection, zinc-dependent gene expression
    Vaccine developmentPotential antigen or drug targetImmunogenicity testing, protective efficacy assessment

ZntB research thus provides a unique window into understanding both bacterial adaptation strategies and host response mechanisms during enteric fever.

What techniques are most effective for studying ZntB expression and regulation during different phases of S. Paratyphi A infection?

Multiple complementary techniques can effectively monitor ZntB expression and regulation during infection:

  • Transcriptional Analysis:

    • RNA-Seq: Provides comprehensive transcriptome profiling during infection

    • RT-qPCR: Enables targeted, quantitative assessment of zntB expression

    • Single-cell RNA-Seq: Reveals population heterogeneity in bacterial response

  • Reporter Systems:

    • Fluorescent Protein Fusions: Construct zntB promoter-GFP fusions to visualize expression patterns

    • Luciferase Reporters: Enable real-time monitoring of zntB expression during infection

    • Dual-Reporter Systems: Allow simultaneous tracking of multiple regulatory pathways

  • Protein-Level Analysis:

    • Western Blotting: Quantifies ZntB protein levels using specific antibodies

    • Proteomics: Identifies co-regulated proteins and post-translational modifications

    • Immunohistochemistry: Localizes ZntB expression within infected tissues

  • Regulatory Network Analysis:

    • ChIP-Seq: Identifies transcription factor binding sites in the zntB promoter

    • DNA Pull-Down: Characterizes protein-DNA interactions at regulatory regions

    • CRISPR Interference: Systematically disrupts potential regulators to map the network

  • Infection Phase-Specific Approaches:

    Infection PhaseRecommended TechniquesKey Parameters to Monitor
    Early infectionRNA-Seq, Reporter systemsInitial ZntB expression in response to host environment
    Intracellular survivalFluorescence microscopy, ProteomicsZntB levels in different intracellular compartments
    Systemic disseminationIn vivo imaging, Tissue-specific RNA isolationTissue-specific regulation patterns
    Persistent infectionLong-term reporter studies, Inducible systemsAdaptation of zinc homeostasis during persistence
  • Infection Models:

    • Cell culture infection models allow for controlled conditions and easy sampling

    • Animal models provide systemic context but with limited sampling options

    • Controlled human infection models offer the most relevant system but with ethical and practical limitations

These methodologies, when applied systematically across infection phases, provide a comprehensive understanding of ZntB regulation in the context of S. Paratyphi A pathogenesis.

How do mutations in the zntB gene affect S. Paratyphi A virulence and survival in different host environments?

Mutations in zntB can have profound effects on S. Paratyphi A pathogenesis through several mechanisms:

  • Functional Impact Categories:

    • Loss-of-function mutations: Impair zinc efflux capacity, potentially leading to zinc toxicity in high-zinc environments

    • Regulatory mutations: Alter expression patterns, disrupting zinc homeostasis timing

    • Gain-of-function mutations: May enhance zinc efflux efficiency but potentially at the cost of substrate specificity

  • Host Environment-Specific Effects:

    Host EnvironmentWild-Type ZntB FunctionMutant ZntB Consequences
    Gastrointestinal tractModerate zinc efflux to handle dietary zincReduced competitive fitness, impaired initial colonization
    Intracellular (macrophage)High zinc efflux to counter host-mediated zinc toxicityIncreased susceptibility to zinc-mediated killing, reduced replication
    Systemic circulationVariable zinc managementImpaired adaptation to changing zinc levels, reduced persistence
  • Virulence Phenotypes:

    • In challenge models, zntB mutations would likely reduce attack rates below the observed 56% for wild-type S. Paratyphi A

    • Distinct metabolite profiles seen in S. Paratyphi A infections could be altered by zntB mutations that impact zinc-dependent metabolism

    • The inflammatory response differences between S. Paratyphi A and S. Typhi infections could be exacerbated by zntB mutations that disrupt zinc homeostasis

  • Compensatory Mechanisms:

    • Alternative zinc transporters may partially compensate for zntB defects

    • Metabolic adaptations may develop to reduce dependence on zinc-requiring enzymes

    • Regulatory network rewiring may occur to maintain zinc homeostasis through alternative pathways

  • Evolutionary Considerations:

    • ZntB sequence conservation across Salmonella serovars suggests functional importance

    • Natural variation in zntB sequences between serovars may reflect adaptation to preferred host niches

    • Experimental evolution under zinc stress could reveal adaptive mutation patterns in zntB

Understanding these mutation effects provides insights into potential therapeutic targets and evolutionary constraints on zinc homeostasis systems in S. Paratyphi A.

What are the emerging technologies that could advance our understanding of ZntB function in S. Paratyphi A?

Several cutting-edge technologies show promise for elucidating ZntB function:

  • Advanced Structural Biology Approaches:

    • Cryo-Electron Microscopy: Enables visualization of ZntB in different conformational states during the transport cycle

    • Single-Particle Analysis: Resolves structural heterogeneity in ZntB complexes

    • Integrative Structural Biology: Combines multiple techniques (X-ray crystallography, NMR, SAXS) for comprehensive structural characterization

  • Real-Time Imaging Technologies:

    • Single-Molecule FRET: Monitors conformational changes in ZntB during transport

    • Live-Cell Zinc Biosensors: Tracks zinc dynamics in bacterial cells during infection

    • Super-Resolution Microscopy: Visualizes ZntB localization and clustering at nanoscale resolution

  • Advanced Functional Characterization:

    • Nanodiscs and Polymer-Based Membrane Mimetics: Provides native-like environments for functional studies

    • Microfluidic Transport Assays: Enables high-throughput functional screening

    • Electrophysiological Approaches: Records transport activity at single-channel resolution

  • Systems Biology Integration:

    • Multi-omics Approaches: Integrates transcriptomics, proteomics, and metabolomics data

    • Machine Learning Analysis: Identifies patterns in complex datasets related to zinc homeostasis

    • Network Modeling: Predicts system-wide effects of ZntB perturbation

  • Emerging Genetic Tools:

    TechnologyApplication to ZntB ResearchExpected Insights
    CRISPR InterferencePrecise modulation of zntB expressionDose-dependent phenotypes
    Multiplex genome editingSimultaneous mutation of zinc homeostasis genesRedundancy and compensation
    Base editingIntroduction of specific point mutationsStructure-function relationships
    OptogeneticsLight-controlled zntB expressionTemporal requirements during infection
  • Infection Model Advances:

    • Organoids and Organ-on-Chip: Provides physiologically relevant infection environments

    • Humanized Animal Models: Better recapitulates human-specific aspects of infection

    • Refined Human Challenge Models: Allows detailed study of zinc dynamics during controlled infection

These emerging technologies will enable unprecedented insights into ZntB function and its role in S. Paratyphi A pathogenesis, potentially leading to novel therapeutic strategies.

What knowledge gaps remain in our understanding of ZntB and S. Paratyphi A virulence that require further investigation?

Despite progress in understanding ZntB, several critical knowledge gaps remain:

  • Structural Determinants of Transport:

    • The precise structural basis for zinc selectivity remains undefined

    • Conformational changes during the transport cycle are poorly characterized

    • Interaction domains with regulatory proteins are unidentified

  • Regulatory Networks:

    • Complete characterization of transcriptional and post-transcriptional regulation of zntB expression is lacking

    • Integration of zinc sensing with other virulence regulatory networks is not fully understood

    • Environmental signals beyond zinc that modulate ZntB function remain to be identified

  • Role in Different Infection Stages:

    • The precise contribution of ZntB to gastrointestinal colonization versus systemic dissemination is unclear

    • Temporal requirements for ZntB function during infection progression need elucidation

    • The impact of host zinc status on infection outcomes mediated by ZntB requires investigation

  • Host-Pathogen Interface:

    • How ZntB activity influences host immune responses is not fully characterized

    • Whether ZntB affects the distinct metabolite profiles observed in S. Paratyphi A versus S. Typhi infections remains unknown

    • The role of ZntB in the incomplete cross-protection between S. Typhi and S. Paratyphi A needs exploration

  • Therapeutic Potential:

    • Druggability of ZntB as a therapeutic target needs validation

    • Population genetics of zntB variation in clinical isolates is incomplete

    • Impact of ZntB inhibition on emergence of resistance requires assessment

  • Key Research Questions Requiring Multidisciplinary Approaches:

    Research QuestionRequired ApproachesPotential Impact
    How does ZntB function differ in the inflammatory environment induced by S. Paratyphi A versus S. Typhi?Comparative metabolomics, inflammatory models, zinc flux measurementUnderstanding serovar-specific pathogenesis mechanisms
    What is the relationship between ZntB function and the limited cross-protection observed between S. Typhi and S. Paratyphi A?Challenge-rechallenge models, immune response profilingImproved vaccine design strategies
    How does ZntB contribute to the differential attack rates observed in human challenge models?Genetic manipulation, controlled infection studiesBetter prediction of infection outcomes

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, genetics, immunology, and clinical research to fully understand ZntB's role in S. Paratyphi A pathogenesis.

How might research on ZntB contribute to the development of novel diagnostics or vaccines for S. Paratyphi A infections?

Research on ZntB offers several promising avenues for translational applications:

By focusing on the unique aspects of ZntB in S. Paratyphi A and its relationship to host response, researchers can develop targeted interventions that address the specific challenges of paratyphoid fever diagnosis and prevention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.