Recombinant Salmonella paratyphi B 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

ubiA catalyzes the transfer of a prenyl group from a polyprenyl diphosphate (XPP) to 4-hydroxybenzoate (4-HB), forming the isoprenoid side chain of ubiquinones . Key enzymatic properties include:

PropertyDetailSource
Catalytic MechanismCleavage of XPP diphosphate → carbocation intermediate → regiospecific C–C bond formation at 4-HB’s meta-position
Substrates4-Hydroxybenzoate (acceptor); XPPs (geranyl-, farnesyl-, octaprenyl-diphosphate donors)
CofactorMg²⁺ ions (required for activity)
Enzyme KineticsK<sub>m</sub> values: Submillimolar range for 4-HB and XPPs

Biological Significance:

  • Ubiquinone Biosynthesis: Essential for electron transport and membrane stability .

  • Antimicrobial Target: Disruption impairs bacterial respiration and survival .

Production and Purification

Recombinant ubiA is expressed in E. coli and purified via affinity chromatography due to the His tag . Challenges include maintaining enzymatic activity during purification, as observed in related UbiA-like enzymes .

ParameterDetailSource
Expression SystemE. coli BL21 (DE3)
YieldHigh expression levels in membrane fractions
PurificationNi-NTA affinity chromatography; detergent-based protocols
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); 5–50% glycerol for stability

Applications in Research and Diagnostics

The recombinant ubiA protein serves as a tool in:

  1. ELISA Kits:

    • Detects antibodies against S. paratyphi B in serological assays .

    • Used to study immune responses in endemic regions .

  2. Vaccine Development:

    • Potential antigenic target for S. paratyphi B vaccines, though limited data exist compared to Paratyphi A .

  3. Enzymatic Studies:

    • Examines substrate specificity and inhibitor development for antimicrobial strategies .

Research Findings and Challenges

  • Substrate Specificity: S. paratyphi B ubiA preferentially uses octaprenyl-diphosphate, distinct from other UbiA homologs .

  • Structural Insights: Homology modeling suggests a conserved Asp-rich Mg²⁺-binding domain and aromatic substrate-binding pocket .

  • Gaps: Limited studies on S. paratyphi B ubiA’s role in pathogenesis or host interaction .

Data Tables

Table 1: Molecular Properties of S. paratyphi B ubiA

PropertyValueSource
Molecular Weight~33 kDa (full length)
Isoelectric Point (pI)Predicted: ~5.5–6.0 (based on E. coli expression)
StabilitySensitive to repeated freeze-thaw cycles

Table 2: Functional Kinetics

ParameterValueSource
Optimal pH7.5–8.5 (Tris/PBS buffer)
Thermal StabilityDegrades above 40°C

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
ubiA; SPAB_05217; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
ubiA
Target Protein Sequence
MEWSLTQSKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGMPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTVNRPLPSGAVTEKEARNLFVVLVLLAFLLVLTLNAMTIL LSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESLPLSCWLMFLANILWA VAYDTQYAMVDRDDDIKIGIKSTAILFGRYDTLIIGILQLGVMALMALIGWLNGLGWGYY WAVLVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. This enzyme mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. This step involves the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is 4-hydroxybenzoate octaprenyltransferase (ubiA) and what is its role in Salmonella metabolism?

4-hydroxybenzoate octaprenyltransferase (ubiA) is a membrane-bound enzyme that catalyzes the conversion of 4-hydroxybenzoate into 3-octaprenyl-4-hydroxybenzoate, representing a critical step in ubiquinone biosynthesis. The enzyme requires magnesium ions (Mg²⁺) for optimal catalytic activity and plays an essential role in bacterial respiratory function . The reaction catalyzed by ubiA is fundamental to energy metabolism across numerous bacterial species, including Salmonella serovars.

In Salmonella metabolism, ubiA functions as part of the electron transport chain, facilitating aerobic respiration. The ubiA gene has been identified as the structural gene encoding this enzyme, as demonstrated through genetic analysis where mutations in this gene result in the absence of 4-hydroxybenzoate octaprenyltransferase activity . Comparative genomic studies of different Salmonella serovars have revealed that while core metabolic functions like ubiA are generally conserved, there can be serovar-specific variations that reflect adaptations to different environmental niches .

How does ubiA in Salmonella paratyphi B compare structurally and functionally to ubiA in other Salmonella serovars?

While the search results don't provide specific comparative data for S. paratyphi B ubiA, we can draw insights from related serovars. The ubiA protein in Salmonella paratyphi A consists of 290 amino acids with multiple transmembrane domains, consistent with its membrane-bound nature . Comparative genomic approaches have confirmed serovar-specific groupings among Salmonella isolates, suggesting potential variations in metabolic enzymes like ubiA across serovars .

Functional conservation is likely high for essential metabolic enzymes like ubiA. Research has shown that in E. coli, the ubiA gene maps to minute 79 on the chromosome . Similar genomic organization might be expected in Salmonella serovars, though specific chromosomal locations may vary. Functional studies using techniques like comparative genomic hybridization (CGH) would be valuable for identifying any significant variations in ubiA across Salmonella serovars .

What methodologies are available for identifying and characterizing the ubiA gene in Salmonella paratyphi B?

Several molecular techniques can be employed for identifying and characterizing the ubiA gene in Salmonella paratyphi B:

What are the recommended approaches for expressing recombinant Salmonella paratyphi B ubiA protein?

Based on methodologies used for similar proteins, the following expression strategies are recommended:

  • Vector Selection: Construct an expression plasmid containing the ubiA gene under control of an inducible promoter system, such as the T5 promoter with a lac operator, similar to approaches used for other bacterial genes .

  • Host Strain Considerations: E. coli expression systems are commonly used, with strains optimized for membrane protein expression being particularly suitable given the membrane-bound nature of ubiA .

  • Expression Conditions:

    • Induction parameters should be optimized (temperature, inducer concentration, duration)

    • Consider lower temperatures (16-25°C) to improve proper folding of membrane proteins

    • Supplementation with Mg²⁺ may be beneficial as it's required for optimal enzyme activity

  • Extraction Strategy: Due to its membrane localization, specialized extraction protocols using appropriate detergents will be necessary to solubilize the protein while maintaining its structural integrity.

What are the optimal conditions for purification and storage of recombinant ubiA protein?

Based on established protocols for similar recombinant proteins from Salmonella paratyphi A, the following conditions are recommended :

Table 1: Recommended Conditions for Purification and Storage of Recombinant ubiA

ParameterRecommended ConditionRationale
Buffer CompositionTris-based buffer with 50% glycerolOptimized for protein stability
Long-term Storage-20°C to -80°CPrevents protein degradation
Working Aliquots4°C for up to one weekMinimizes freeze-thaw cycles
Freeze-Thaw CyclesAvoid repeated freezing and thawingMaintains enzyme activity
Cofactor InclusionMg²⁺ supplementationRequired for optimal enzyme activity

For purification, researchers should consider:

  • Incorporating affinity tags (His-tag, FLAG-tag) to facilitate purification

  • Utilizing specialized chromatography methods suitable for membrane proteins

  • Including protease inhibitors throughout the purification process to prevent degradation

  • Verifying protein purity using SDS-PAGE and Western blotting techniques

What experimental approaches can be used to assess the enzymatic activity of recombinant ubiA?

Several experimental approaches can be employed to assess ubiA enzymatic activity:

  • In vitro Enzyme Assays: Measure the conversion of 4-hydroxybenzoate to 3-octaprenyl-4-hydroxybenzoate using purified recombinant protein. This assay requires:

    • 4-hydroxybenzoate substrate

    • Prenyl donor (octaprenyl diphosphate)

    • Mg²⁺ as a cofactor

    • Appropriate membrane-mimicking environment

    • Detection methods such as HPLC or radioisotope labeling

  • Complementation Studies: Introduce the recombinant ubiA gene into ubiA-deficient bacterial strains and assess restoration of:

    • Ubiquinone biosynthesis

    • Aerobic growth capacity

    • Respiratory function

  • Comparative Analysis: Compare enzyme kinetics parameters (Km, Vmax, catalytic efficiency) of ubiA from different Salmonella serovars to identify potential functional differences.

How can researchers resolve inconsistent activity results when working with recombinant ubiA?

When facing inconsistent activity results, researchers should systematically evaluate:

  • Protein Integrity: Confirm proper folding and stability using techniques such as circular dichroism or thermal shift assays.

  • Membrane Environment: As a membrane-bound enzyme, ubiA activity is highly dependent on the lipid environment. Consider:

    • Testing different detergent types and concentrations

    • Utilizing liposomes or nanodiscs to mimic native membrane environments

    • Ensuring proper orientation of the protein in membrane mimetics

  • Cofactor Requirements: Ensure sufficient Mg²⁺ is present, as it's essential for optimal enzyme activity . Titrate different concentrations to determine optimal levels.

  • Substrate Quality: Verify the purity and integrity of both 4-hydroxybenzoate and prenyl donor substrates.

  • Assay Conditions: Systematically optimize pH, temperature, ionic strength, and reaction time.

How can ubiA be utilized in vaccine development strategies against Salmonella paratyphi B?

The ubiA enzyme presents several opportunities for vaccine development strategies:

  • Attenuated Live Vaccine Development: Similar to approaches used with other genes (guaBA and clpX) in Salmonella vaccines, mutations in ubiA could potentially create attenuated strains suitable for live vaccine development . Since ubiA is involved in essential metabolic functions, controlled attenuation through specific mutations could generate strains that remain immunogenic while having reduced virulence.

  • Comparative Genomics Approach: Genomic analyses have revealed limited genetic differences between Salmonella Paratyphi B sensu stricto and other serovars . These comparative genomic approaches could identify specific features of ubiA that might be exploited for vaccine development.

  • Structural Vaccinology: Determining epitopes of ubiA that are immunogenic and conserved across strains could inform the design of subunit vaccines targeting this protein.

  • Combination Strategies: A comprehensive vaccine approach might combine ubiA-based attenuation with mutations in other genes like guaBA, which has previously been used in Salmonella vaccine development .

What role does ubiA play in Salmonella paratyphi B pathogenesis and how might this inform antimicrobial development?

While direct evidence from the search results is limited, several inferences can be made regarding ubiA's role in pathogenesis:

  • Metabolic Fitness: As ubiA is essential for ubiquinone biosynthesis and thus aerobic respiration, it likely contributes significantly to Salmonella's metabolic fitness during infection. Inhibition of ubiA could potentially reduce bacterial survival in host environments.

  • Host Adaptation: Comparative genomics of Salmonella serovars has revealed that while certain genes may be inactivated in host-restricted serovars, core metabolic pathways often remain intact . The conservation of ubiA across serovars suggests its importance for survival across different host environments.

  • Antimicrobial Development Potential: The essential nature of ubiA makes it an attractive target for antimicrobial development. Structure-based drug design approaches could be employed to develop specific inhibitors of this enzyme that might disrupt Salmonella metabolism with minimal effects on host cells.

  • Resistance Considerations: Since ubiA is involved in fundamental metabolic processes, resistance to ubiA inhibitors might be less likely to develop compared to antibiotics targeting non-essential functions.

How can whole genome sequencing and comparative genomics approaches enhance our understanding of ubiA in Salmonella paratyphi B?

Whole genome sequencing (WGS) and comparative genomics provide powerful tools for investigating ubiA:

  • High-Resolution Phylogenetic Analysis: WGS has been successfully applied to analyze Salmonella outbreaks, revealing close genetic relationships between isolates (0-4 hqSNP differences) . Similar approaches could identify strain-specific variations in ubiA across Salmonella paratyphi B isolates.

  • Identification of Natural Variants: Comparative genomics can identify natural variants of ubiA across different isolates, potentially linking specific sequence variations to functional differences or virulence characteristics.

  • Metabolic Pathway Reconstruction: WGS data enables the reconstruction of complete metabolic pathways, allowing researchers to understand how ubiA functions within the broader context of Salmonella metabolism and how this might differ between host-restricted and broad-host-range serovars .

  • Evolutionary Insights: Comparative genomics approaches can reveal the selective pressures acting on ubiA throughout Salmonella evolution, potentially identifying regions under purifying selection (functionally critical) versus those under diversifying selection.

What are the critical controls needed when designing experiments with recombinant ubiA?

Robust experimental design requires several critical controls:

  • Positive Controls:

    • Wild-type ubiA protein with confirmed activity

    • Known functional homologs from related organisms (E. coli ubiA)

    • Positive reference standards for activity assays

  • Negative Controls:

    • Catalytically inactive ubiA mutants (site-directed mutagenesis of key residues)

    • Empty vector controls for expression studies

    • Heat-inactivated enzyme preparations

  • Experimental Validation Controls:

    • Multiple independent protein preparations to ensure reproducibility

    • Enzyme concentration gradients to confirm linearity of activity assays

    • Time-course experiments to establish optimal reaction kinetics

    • Substrate specificity controls using structural analogs

  • For in vivo studies:

    • Complementation controls using wild-type gene to rescue mutant phenotypes

    • Heterologous expression controls to verify functionality across species

    • Appropriate vehicle controls for drug screening applications

What methodological challenges are commonly encountered when working with recombinant ubiA and how can they be addressed?

Working with membrane proteins like ubiA presents several challenges:

  • Protein Expression Issues:

    • Challenge: Low expression levels or formation of inclusion bodies

    • Solution: Optimize codon usage, reduce expression temperature, use specialized expression strains, or employ fusion tags that enhance solubility

  • Protein Solubilization:

    • Challenge: Difficulty extracting functional protein from membranes

    • Solution: Screen multiple detergents, use milder extraction conditions, consider native nanodiscs or liposome reconstitution

  • Activity Preservation:

    • Challenge: Loss of enzymatic activity during purification

    • Solution: Include stabilizing agents (glycerol, specific lipids), maintain Mg²⁺ throughout purification, minimize exposure to air/oxidation

  • Assay Development:

    • Challenge: Establishing reliable activity assays for membrane enzymes

    • Solution: Develop multiple complementary assay formats (direct product detection, coupled enzyme assays), optimize reaction conditions systematically

  • Structural Analysis:

    • Challenge: Obtaining structural information for membrane proteins

    • Solution: Consider cryo-EM approaches, detergent screening for crystallization, or computational modeling based on homologous proteins

What are the most significant recent findings regarding ubiA in Salmonella and related bacteria?

Recent research has provided several important insights:

  • Vaccine Development: Live attenuated Salmonella enterica serovar Paratyphi B vaccines have been developed using mutations in genes like guaBA and clpX, demonstrating the potential of metabolic attenuation strategies that could be applied to ubiA .

  • Comparative Genomics: Genomic analyses have confirmed serovar-specific groupings of Salmonella isolates and revealed limited genetic differences between Salmonella Paratyphi B sensu stricto strains . These findings suggest conserved metabolic pathways that likely include ubiA.

  • Clinical Relevance: While the incidence of invasive Salmonella Paratyphi B sensu stricto infections is currently low, the development of new vaccines against other enteric fever serovars could potentially lead to the emergence of S. Paratyphi B to fill ecological niches .

  • Methodological Advances: Whole genome sequencing (WGS) has been successfully applied to investigate Salmonella outbreaks, providing high-resolution phylogenetic analysis that could be applied to studying ubiA variation across isolates .

What unresolved questions about ubiA in Salmonella paratyphi B warrant further investigation?

Several important questions remain unanswered:

  • Structural Characterization: What is the three-dimensional structure of Salmonella paratyphi B ubiA, and how does it compare to homologs in other bacteria?

  • Regulatory Mechanisms: How is ubiA expression regulated in response to environmental conditions encountered during infection?

  • Host-Pathogen Interactions: Does ubiA activity or expression change during infection, and how does this impact Salmonella survival within host cells?

  • Antimicrobial Potential: Can specific inhibitors of ubiA be developed that selectively target Salmonella without affecting commensal bacteria or host cells?

  • Evolutionary Adaptation: How has ubiA evolved across Salmonella serovars, and do these changes correlate with host adaptation or virulence?

How can emerging technologies enhance research on ubiA in Salmonella paratyphi B?

Several emerging technologies offer promising avenues for advancing ubiA research:

  • CRISPR-Cas9 Gene Editing: Precise modification of the ubiA gene to study structure-function relationships and create attenuated strains for vaccine development.

  • Single-Cell Techniques: Investigate heterogeneity in ubiA expression and activity within bacterial populations during infection.

  • Advanced Structural Biology: Cryo-electron microscopy and advanced NMR techniques could provide detailed structural insights into membrane-bound ubiA.

  • Systems Biology Approaches: Integration of transcriptomics, proteomics, and metabolomics data to understand how ubiA functions within the broader metabolic network of Salmonella.

  • High-Throughput Screening: Development of assay systems suitable for screening chemical libraries to identify selective inhibitors of ubiA activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.