Recombinant Salmonella paratyphi B ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to Salmonella paratyphi B and ATP Synthase

Salmonella paratyphi B represents a significant gram-negative enteric pathogen within the Salmonella genus. This bacterium exists in two distinct biotypes that share identical somatic antigen profiles (1,4,12) and flagellar antigens (b:1,2): the Java biotype (dt+) and the sensu stricto biotype (dt-) . The sensu stricto biotype produces a slime wall and causes paratyphoid fever in humans, while the Java biotype lacks this slime wall production and typically causes gastroenteritis, although it has demonstrated lower virulence compared to the sensu stricto biotype . Understanding the molecular components that contribute to the pathogenicity of these bacteria, including the ATP synthase complex, is crucial for developing targeted therapeutic approaches.

The F1Fo ATP synthase operates as a molecular motor that couples proton translocation to ATP synthesis/hydrolysis. This complex is particularly critical for intracellular pathogens that inhabit membrane-bound acidic compartments within host cells . The complex consists of two major components: the membrane-embedded Fo sector (containing subunits a, b, b', and c) and the catalytic F1 sector (containing subunits α, β, γ, δ, and ε). The atpB gene encodes the subunit a (AtpB) of the Fo sector, which forms the proton channel essential for enzyme function . This subunit plays a pivotal role in both the pathogen's energy metabolism and its ability to survive within host environments.

Genetic Organization and Expression

The atpB gene in Salmonella species is part of the highly conserved atp operon that encodes the components of the F1Fo ATP synthase. While specific information about the atpB gene in S. paratyphi B is limited in the provided research, studies on related Salmonella strains indicate that expression of ATP synthase components is tightly regulated in response to environmental conditions, particularly during infection processes.

The AtpB protein, as part of the Fo sector, contains multiple transmembrane helices that anchor the ATP synthase complex in the bacterial membrane. These transmembrane domains create a channel through which protons can flow, driving the rotational motion that enables ATP synthesis in the F1 sector. Structural studies on bacterial F1Fo ATP synthases suggest that AtpB forms a critical interface with the c-ring, facilitating the proton translocation mechanism essential for energy conversion.

Role in Energy Metabolism

The F1Fo ATP synthase serves as the primary enzyme for ATP production through oxidative phosphorylation in bacteria. The AtpB subunit specifically contributes to this process by forming part of the proton channel in the membrane-embedded Fo sector. Research on related Salmonella strains demonstrates that a functional F1Fo ATP synthase is indispensable for intracellular pathogens that reside within membrane-bound acidic compartments . Inactivation of atpB significantly impacts bacterial survival within these environments, highlighting its crucial role in pathogen viability.

The mechanism of action involves coupling proton translocation through the Fo sector to ATP synthesis in the F1 sector. Protons moving through the channel formed by AtpB and the c-ring drive the rotation of the c-ring, which is coupled to the rotation of the γ-stalk in the F1 region. This rotational motion enables the catalysis of ATP synthesis at the interfaces of the α and β subunits in the F1 sector.

Significance in Pathogenesis

AtpB plays a critical role in Salmonella pathogenesis beyond its basic function in energy metabolism. Research reveals that virulence factors like MgtC interact with the AtpB subunit, modulating ATP synthase activity to enhance pathogen survival within macrophages . This interaction inhibits ATP-driven proton translocation and NADH-driven ATP synthesis, thereby maintaining physiological ATP levels and cytoplasmic pH during infection .

Studies have shown that MgtC binds directly to AtpB, hindering its normal function and consequently affecting bacterial growth and virulence . This relationship demonstrates how pathogens can manipulate their own energy metabolism to optimize survival within hostile host environments. The interaction between MgtC and AtpB represents a unique mechanism where a virulence protein targets the bacterium's own ATP synthase rather than host proteins, distinguishing it from classical secreted virulence factors .

Expression Systems

The recombinant production of membrane proteins like AtpB presents significant challenges due to their hydrophobic nature and complex folding requirements. For ATP synthase components, expression systems employing E. coli have been widely utilized, though specific protocols for S. paratyphi B AtpB are not detailed in the provided search results.

Based on related research on ATP synthase components, successful expression strategies might include:

  • Use of specialized E. coli strains designed for membrane protein expression

  • Fusion with solubility-enhancing tags such as maltose-binding protein (MBP)

  • Controlled expression using inducible promoters to prevent toxicity

Purification Strategies

Purification of recombinant AtpB typically involves a multi-step process designed to isolate the protein while maintaining its native structure and function. Although specific protocols for S. paratyphi B AtpB purification are not detailed in the search results, techniques employed for similar membrane proteins may include:

  1. Membrane solubilization using appropriate detergents

  2. Affinity chromatography leveraging fusion tags

  3. Size exclusion chromatography for final purification

Table 1: Comparison of Potential Purification Methods for Recombinant AtpB

Purification MethodAdvantagesLimitationsApplication to AtpB
Detergent SolubilizationEffective extraction from membranesPotential denaturationInitial membrane protein extraction
Affinity ChromatographyHigh selectivityTag may affect functionPrimary purification step
Ion ExchangeSeparation based on chargeBuffer limitationsSecondary purification
Size ExclusionSeparation by molecular sizeLower resolutionFinal polishing step
Native PAGEMaintains protein-protein interactionsLow throughputQuality control

AtpB-MgtC Interaction

One of the most significant interactions of AtpB in Salmonella is with the virulence protein MgtC. This interaction has profound implications for bacterial pathogenesis. MgtC is required for Salmonella survival within macrophages and for causing lethal infections in mice . Research demonstrates that MgtC interacts with the a subunit (AtpB) of the F1Fo ATP synthase, inhibiting ATP-driven proton translocation and NADH-driven ATP synthesis in inverted vesicles .

This interaction represents a unique virulence mechanism where MgtC targets Salmonella's own F1Fo ATP synthase rather than host proteins. By inhibiting the ATP synthase, MgtC helps maintain physiological ATP levels and cytoplasmic pH, which is crucial for pathogen survival within macrophages .

Regulatory Mechanisms

The interaction between AtpB and virulence factors is subject to complex regulatory mechanisms. For instance, the anti-virulence protein CigR competes with AtpB for binding to MgtC, thereby preventing MgtC from inhibiting the F1Fo ATP synthase . This competition was demonstrated both in vitro and in vivo, where expression of the cigR gene from a heterologous promoter reduced the interaction between AtpB and MgtC proteins .

Table 2: Protein Interactions Influencing AtpB Function

Interacting ProteinFunctionEffect on AtpBConsequence for Pathogenesis
MgtCVirulence proteinInhibits F1Fo ATP synthaseEnhanced survival in macrophages
CigRAnti-virulence proteinPrevents MgtC-AtpB interactionReduced virulence
PhoPMaster regulatorIndirect effect via MgtC regulationCommits to virulence program

Therapeutic Target Development

The essential role of AtpB in bacterial energy metabolism and its interactions with virulence factors make it a promising target for novel antimicrobial therapeutics. Compounds that specifically target the AtpB subunit could potentially disrupt ATP synthesis in pathogenic bacteria without affecting host cells, providing a selective approach to combat bacterial infections.

Additionally, understanding the interaction between AtpB and virulence factors like MgtC offers opportunities to develop inhibitors that could prevent this interaction, thereby reducing bacterial survival within host cells. Such approaches could be particularly valuable for addressing infections caused by antimicrobial-resistant strains of Salmonella paratyphi B.

Vaccine Development

Recombinant AtpB protein could potentially serve as a component in subunit vaccines against Salmonella paratyphi B. By inducing immune responses against this essential protein, such vaccines might provide protection against infection while avoiding the risks associated with live attenuated vaccines.

Functional Studies

Further research is needed to fully understand the role of AtpB in S. paratyphi B pathogenesis. Specific areas for investigation include:

  1. The impact of AtpB mutations on bacterial virulence

  2. Differential expression of AtpB during various stages of infection

  3. Strain-specific variations in AtpB structure and function

  4. The complete interactome of AtpB in the context of bacterial pathogenesis

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpB; SPAB_04812; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
atpB
Target Protein Sequence
MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMF RSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL LPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH
Uniprot No.

Target Background

Function

Key component of the proton channel; it plays a direct role in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does atpB contribute to Salmonella pathogenesis?

The atpB gene product plays a significant role in Salmonella virulence through its function in energy metabolism and bacterial adaptation to host environments. Research has demonstrated that mutations in atpB lead to substantial attenuation in multiple Salmonella serovars, including Typhimurium, Dublin, and Gallinarum, across various host systems .

Mechanistically, atpB contributes to pathogenesis in several ways:

  • Maintenance of intracellular pH: ATP synthase is critical for bacterial adaptation to acidic environments encountered within host cells, particularly phagocytes.

  • Energy provision for virulence factor expression: The ATP generated by the F1Fo complex provides energy for numerous virulence mechanisms.

  • Interaction with virulence regulators: The ATP synthase subunit interacts with virulence proteins such as MgtC, which inhibits ATP synthase activity during infection .

Studies have shown that atpB mutants exhibit reduced invasiveness in vivo, decreased survival within phagocytic cells, and impaired acid tolerance, all of which contribute to attenuated virulence .

What are the optimal storage conditions for recombinant Salmonella paratyphi B atpB protein?

For optimal stability and activity, recombinant Salmonella paratyphi B ATP synthase subunit a should be stored according to the following protocol:

  • Short-term storage (1-2 weeks): Store working aliquots at 4°C in a Tris-based buffer containing 50% glycerol.

  • Long-term storage: Maintain at -20°C, with extended storage preferably at -80°C to prevent protein degradation.

  • Avoid repeated freeze-thaw cycles, as this can significantly reduce protein activity and structural integrity.

  • For experimental use, prepare small working aliquots that can be used within one week .

The protein is typically supplied in a stabilizing buffer optimized for this specific membrane protein, which helps maintain its native conformation and functional properties .

How does the interaction between MgtC and atpB affect Salmonella virulence regulation?

The interaction between MgtC and atpB represents a sophisticated regulatory mechanism in Salmonella virulence. MgtC, a virulence factor expressed within macrophages, directly binds to and inhibits the F1Fo ATP synthase, with atpB being a key target of this interaction .

This inhibitory interaction serves several critical functions:

  • Cytoplasmic pH regulation: By inhibiting ATP synthase, MgtC helps Salmonella maintain its cytoplasmic pH near 7 when experiencing the mildly acidic environment inside macrophages .

  • Metabolic adaptation: This inhibition reduces cellular ATP levels, which correlates with decreased rRNA transcription when cytosolic conditions prevent functional ribosome assembly .

  • Virulence gene expression: MgtC prevents degradation of PhoP, a master regulator of Salmonella pathogenesis, thereby enhancing virulence gene expression .

Interestingly, Salmonella produces CigR, an anti-virulence protein that competes with atpB for binding to MgtC. When CigR binds MgtC, it prevents MgtC from inhibiting the ATP synthase, thereby establishing a regulatory threshold. The virulence program is only activated when MgtC protein levels exceed those of CigR .

Experimental data shows that cigR mutants exhibit lower ATP levels and ATPase activity compared to wild-type Salmonella, which are opposite to the phenotypes displayed by mgtC mutants. This finding confirms that CigR functions by counteracting MgtC's inhibition of the ATP synthase .

What approaches can be used to study atpB mutations for vaccine development?

Developing attenuated Salmonella vaccines through atpB mutation requires a systematic approach:

  • Mutation Generation Strategies:

    • Site-directed mutagenesis targeting conserved functional domains

    • Whole gene deletion using homologous recombination

    • Point mutations in critical residues identified through structural analysis

  • Attenuation Assessment Protocol:

    • In vitro growth curves in various media conditions

    • Acid tolerance response testing (pH 3.0-5.0)

    • Intracellular survival assays in macrophage cell lines

    • Animal virulence models specific to the Salmonella serovar

Studies have demonstrated that mutations in the atp operon (including atpB and atpH) consistently produce high levels of attenuation across multiple Salmonella serovars, making them excellent candidates for broad-spectrum vaccine development .

Salmonella SerovarHost ModelatpB Mutation EffectReference
Typhimurium1-day-old chickensHighly attenuatedTurner et al., 2003
TyphimuriumMouse modelHighly attenuatedTurner et al., 2003
Dublin6-week-old miceHighly attenuatedTurner et al., 2003
Gallinarum3-week-old chickensHighly attenuatedTurner et al., 2003

When developing atpB-based vaccines, researchers should consider the following factors:

  • Stability of attenuation in vivo

  • Immunogenicity of the attenuated strain

  • Potential for reversion to virulence

  • Balance between attenuation and immunostimulatory properties

How can researchers differentiate between the direct and indirect effects of atpB mutations on Salmonella virulence?

Differentiating between direct and indirect effects of atpB mutations requires a multi-faceted experimental approach:

  • Complementation Studies:

    • Express wild-type atpB from a plasmid in the mutant strain

    • Compare phenotype restoration to confirm direct causality

    • Use point mutations in key functional domains to identify essential residues

  • Protein-Protein Interaction Analysis:

    • Perform co-immunoprecipitation experiments to identify interaction partners

    • Use bacterial two-hybrid systems to confirm direct protein interactions

    • Conduct pull-down assays with purified components to verify direct binding

  • Metabolic Profiling:

    • Compare ATP levels, proton motive force, and intracellular pH between wild-type and mutant strains

    • Measure expression of genes affected by energy status using qRT-PCR

    • Perform metabolomic analysis to identify downstream metabolic alterations

  • Temporal Analysis:

    • Study the expression patterns of atpB and interacting proteins (like MgtC and CigR) over time during infection

    • Compare when phenotypic changes occur relative to protein expression changes

Research has shown that the effects of atpB mutation on virulence are likely both direct (through impaired energy production) and indirect (through altered expression of virulence factors). For example, experiments with the regulators CigR and MgtC demonstrate that when MgtC protein amounts exceed those of CigR (approximately 4 hours after induction), ATP levels decrease significantly, indicating that timing of protein expression is critical for virulence regulation .

What are the optimized protocols for expressing and purifying recombinant Salmonella paratyphi B atpB?

Successful expression and purification of recombinant Salmonella paratyphi B atpB requires specialized techniques for membrane proteins:

  • Expression System Selection:

    • E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

    • Vector systems with tunable promoters (e.g., T7lac) to control expression levels

    • Inclusion of appropriate fusion tags (His-tag, MBP, or SUMO) to aid solubility and purification

  • Optimized Expression Protocol:

    • Culture growth at lower temperatures (16-20°C) after induction

    • Use of reduced inducer concentrations (0.1-0.4 mM IPTG)

    • Extended expression periods (16-24 hours)

    • Supplementation with membrane-stabilizing additives

  • Membrane Protein Extraction:

    • Gentle cell lysis using French press or sonication

    • Membrane fraction isolation through differential centrifugation

    • Solubilization using appropriate detergents (DDM, LDAO, or C12E8)

    • Detergent screening to maintain protein stability and activity

  • Purification Strategy:

    • Immobilized metal affinity chromatography (IMAC) as initial capture step

    • Size exclusion chromatography for further purification

    • Buffer optimization containing glycerol and specific detergent concentrations

    • Quality assessment using SDS-PAGE, Western blotting, and activity assays

The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term use or -80°C for long-term storage .

How can researchers effectively measure the functional activity of recombinant atpB in vitro?

Assessing the functional activity of recombinant atpB requires techniques that can measure its role in the ATP synthase complex:

  • ATP Hydrolysis (ATPase) Activity:

    • Spectrophotometric assay coupling ATP hydrolysis to NADH oxidation

    • Measurement of inorganic phosphate release using colorimetric methods

    • Comparison of activity in the presence and absence of specific inhibitors

  • Proton Translocation Measurement:

    • Reconstitution of purified protein into liposomes

    • Monitoring pH changes using pH-sensitive fluorescent dyes

    • Assessment of membrane potential using voltage-sensitive probes

  • Protein-Protein Interaction Assays:

    • Surface plasmon resonance (SPR) to determine binding kinetics with partners like MgtC

    • Microscale thermophoresis to measure binding affinities

    • FRET-based assays to monitor interactions in real-time

  • Structural Integrity Assessment:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Limited proteolysis to verify proper folding

    • Thermal shift assays to determine protein stability

Experimental data from wild-type and mutant Salmonella strains has shown that changes in ATP synthase activity correlate with virulence phenotypes. For example, cigR mutants exhibited lower ATPase activity than wild-type Salmonella, while mgtC mutants showed higher activity, demonstrating the regulatory relationship between these proteins and ATP synthase function .

What techniques are most effective for studying atpB-protein interactions in Salmonella?

Several techniques have proven valuable for investigating atpB interactions with other proteins:

  • Co-immunoprecipitation (Co-IP):

    • Use of specific antibodies against atpB or its interaction partners

    • Cross-linking approaches to capture transient interactions

    • Mass spectrometry analysis of co-precipitated proteins

    • Western blot validation of specific interaction partners

  • Bacterial Two-Hybrid Systems:

    • Adaptation of bacterial two-hybrid assays for membrane protein interactions

    • Use of split-ubiquitin systems specifically designed for membrane proteins

    • Quantification of interaction strength through reporter gene expression

  • Microscopy-Based Approaches:

    • Fluorescence colocalization studies using fluorescent protein fusions

    • FRET microscopy to detect direct protein interactions in bacterial cells

    • Super-resolution microscopy to precisely locate interaction complexes

  • Biochemical Validation:

    • Pull-down assays using purified components

    • Competition assays to determine binding sites and affinities

    • Mutagenesis studies to identify critical residues for interaction

Research has demonstrated that MgtC interacts directly with atpB, and this interaction is disrupted by the anti-virulence protein CigR. The MgtC N92T variant was defective for interaction with atpB, highlighting the importance of specific residues in mediating protein-protein interactions .

How do mutations in atpB affect Salmonella survival within macrophages?

ATP synthase mutations significantly impact Salmonella survival within macrophages through multiple mechanisms:

  • Intracellular pH Regulation:

    • Wild-type Salmonella maintains near-neutral cytoplasmic pH despite acidic macrophage environments

    • atpB mutants exhibit impaired ability to regulate internal pH, leading to decreased survival

    • Cytoplasmic pH measurements show that cigR mutants (which have enhanced MgtC inhibition of ATP synthase) maintain higher pH than wild-type Salmonella inside macrophages

  • Energy Production:

    • ATP synthesis is crucial for powering various virulence mechanisms

    • atpB mutants show reduced ATP levels, limiting energy available for survival processes

    • Experiments demonstrate that atpB mutations cause significant attenuation in macrophage survival assays

  • Virulence Gene Expression:

    • ATP status affects expression of various virulence factors

    • atpB mutants show altered PhoP-dependent gene expression

    • cigR mutants (with enhanced MgtC-mediated inhibition of ATP synthase) produce more PhoP-activated mRNAs than wild-type Salmonella

  • Acid Tolerance Response:

    • atpB mutants show impaired adaptation to acidic conditions rather than general acid sensitivity

    • This defect significantly impacts survival within the acidified phagosome environment

Experimental data shows that atpB mutants are less invasive in vivo and demonstrate reduced survival within phagocytic cells across multiple Salmonella serovars, confirming the critical role of ATP synthase in intracellular survival .

What is the relationship between atpB and temporal regulation of virulence in Salmonella infection?

The temporal regulation of atpB function during Salmonella infection involves a sophisticated interplay with other proteins:

  • Expression Timing Dynamics:

    • CigR protein is constitutively expressed through a PhoP-independent promoter before infection

    • MgtC expression is induced under infection-like conditions (low Mg2+, acidic pH)

    • Experimental data shows that CigR protein amounts are >20 times higher than MgtC's at early times after induction

    • MgtC protein levels increase dramatically starting at 3 hours post-induction and exceed CigR levels by 4 hours

  • Functional Consequences:

    • At early infection stages (0-3 hours), CigR prevents MgtC from inhibiting ATP synthase

    • As infection progresses (4+ hours), MgtC levels exceed CigR, allowing inhibition of ATP synthase

    • This creates a threshold effect where MgtC-dependent phenotypes only manifest when MgtC protein amounts exceed CigR's

  • Metabolic Transition:

    • Early infection: High ATP levels and ATPase activity

    • Late infection: Reduced ATP synthesis, altered metabolism, enhanced virulence gene expression

  • Gene Expression Regulation:

    • The cigR gene is transcribed both constitutively and as part of the MgtC operon

    • This dual regulation ensures proper temporal control of ATP synthase inhibition

    • PhoP-dependent transcription becomes the dominant source of cigR expression in later infection stages

Time Post-InductionCigR:MgtC RatioATP LevelsVirulence Program Status
0-3 hoursCigR > MgtCNormalInactive
4+ hoursMgtC > CigRReducedActive

This temporal regulation mechanism ensures that Salmonella only commits to the metabolically costly virulence program after persistent exposure to host conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.