Recombinant Salmonella paratyphi B Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize its incorporation.
Synonyms
aas; SPAB_03746; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-719
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
aas
Target Protein Sequence
MLFGFFRNLFRVLYRVRVTGDVRALQGNRVLITPNHVSFIDGMLLALFLPVRPVFAVYTS ISQQWYMRWLTPLIDFVPLDPTKPMSIKHLVRLVEQGRPVVIFPEGRISVTGSLMKIYDG AGFVAAKSGATVIPLRIDGAELTPFSRLKGLVKRRLFPRIQLHILPPTQIPMPEAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLVAQYRYGAGKNCIEDINFTPDTYRKLLTK TLFVGRILEKYSVEGEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTPADKLWIFAHLLAPRLAQV KQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTANDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLAVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETERGWYDTGDIVR FDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDASKGEALVLFT TDSELTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGKPDFVTLKSWVDAPEQHHE
Uniprot No.

Target Background

Function

This bifunctional protein plays a critical role in lysophospholipid acylation. Specifically, it catalyzes the transfer of fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-ACP intermediate. This process requires ATP and magnesium. Its physiological function is the regeneration of phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a byproduct of transacylation reactions or phospholipase A1 degradation.

Database Links
Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Recombinant Salmonella paratyphi B Bifunctional protein aas (aas) and what are its key characteristics?

    Recombinant Salmonella paratyphi B Bifunctional protein aas is a full-length protein (amino acids 1-719) derived from Salmonella paratyphi B, corresponding to UniProt accession number A9N3H8. It is typically produced as a recombinant protein with an N-terminal His-tag for purification purposes and expressed in E. coli expression systems . The "bifunctional" designation indicates dual enzymatic or structural roles, which is common among bacterial metabolic proteins. The recombinant form maintains the complete amino acid sequence of the native protein while adding the His-tag to facilitate isolation through immobilized metal affinity chromatography.

    Table 1: Key Characteristics of Recombinant Salmonella paratyphi B Bifunctional protein aas

    CharacteristicDescription
    Protein LengthFull Length (1-719 amino acids)
    Expression SystemE. coli
    TagN-terminal His-tag
    FormLyophilized powder
    Purity>90% (SDS-PAGE verified)
    Molecular MassApproximately 78-80 kDa (estimated)
  • What are the optimal storage and handling conditions for Recombinant Salmonella paratyphi B Bifunctional protein aas?

    Proper storage and handling are critical for maintaining protein stability and activity. The recommended protocols for Recombinant Salmonella paratyphi B Bifunctional protein aas are :

    Table 2: Storage and Handling Guidelines

    ParameterRecommendation
    Long-term storage-20°C to -80°C
    Working aliquots4°C for up to one week
    Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
    ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
    StabilizationAdd glycerol to 5-50% final concentration for freezing
    Important precautionsAvoid repeated freeze-thaw cycles; centrifuge vial before opening

    The methodological approach to reconstitution should include:

    1. Brief centrifugation of the vial before opening

    2. Addition of deionized sterile water to the recommended concentration

    3. Gentle mixing until completely dissolved

    4. Addition of glycerol for preparations intended for long-term storage

    5. Division into small single-use aliquots to prevent freeze-thaw degradation

  • How does Salmonella paratyphi B relate to other Salmonella strains in phylogenetic and virulence contexts?

    Salmonella paratyphi B belongs to Salmonella enterica subspecies enterica, the group responsible for most human Salmonella infections. Within the Salmonella taxonomy, paratyphi B represents a complex serotype with distinct clinical and genetic characteristics :

    Table 3: Comparative Analysis of Salmonella paratyphi B Lineages

    Lineaged-Tartrate FermentationMajor Clinical PresentationGeographic DistributionKey Genetic Features
    O:5 antigen positiveVariableMixed (gastroenteritis and invasive)WidespreadAdditional fimbrial and virulence genes, may contain SGI-1
    O:5 antigen negativePositive (dT+)Primarily gastroenteritisBelgium, Netherlands, Germany (poultry)Multidrug resistant, fewer virulence determinants
    Phylogenetic Group 1 (PG1)Negative (dT-)Strong association with invasive diseaseHistorical lineageSpecific virulence repertoire

    Methodologically, researchers distinguish these lineages through:

    1. Serotyping based on lipopolysaccharide (O) and flagellar (H) antigens

    2. PCR-based detection of the O:5 antigen-encoding oafA gene

    3. d-Tartrate fermentation assays

    4. Whole genome sequencing with SNP-based phylogenetic analysis

    5. Virulence gene profiling using specific genetic markers

  • What genotyping tools are available for Salmonella paratyphi research and how are they applied?

    Several genotyping frameworks have been developed to characterize Salmonella paratyphi strains:

    1. Paratype: A single nucleotide polymorphism (SNP) based genotyping scheme specifically developed for Salmonella Paratyphi A, categorizing strains into three primary clades, nine secondary clades, and 18 genotypes . Each genotype has a unique allele definition located on a conserved gene.

    2. Multi-Locus Sequence Typing (MLST): Used for broader Salmonella classification, including paratyphi B variants.

    3. Whole Genome Sequencing (WGS) approaches that identify:

      • Antimicrobial resistance markers

      • O-polysaccharide synthesis locus mutations

      • Phylogenetic groups based on core genome SNPs

    Methodologically, researchers can implement these tools through:

    1. DNA extraction from pure bacterial cultures

    2. PCR amplification of target loci or whole genome sequencing

    3. Bioinformatic analysis using specialized software like Paratype (available at https://github.com/CHRF-Genomics/Paratype)

    4. Phylogenetic tree construction based on SNP patterns

    5. Integration with antimicrobial resistance and virulence profiling data

Advanced Research Questions

  • What are the predicted functional domains of Salmonella paratyphi B Bifunctional protein aas and how can they be experimentally verified?

    Based on sequence analysis of the 719-amino acid protein, several putative functional domains can be predicted:

    Table 4: Predicted Functional Domains and Verification Methods

    DomainApproximate PositionPredicted FunctionExperimental Verification Method
    N-terminal domainaa 1-250Membrane interaction, substrate recognitionSite-directed mutagenesis, liposome binding assays
    Central catalytic domainaa 251-500ATP binding, enzymatic activityATP binding assays, activity measurements with domain-specific substrates
    C-terminal domainaa 501-719Secondary catalytic function, protein-protein interactionCo-immunoprecipitation, truncation analysis
    ATP-binding motifaa ~450-470"FTSGSEGHPKG" region suggesting ATP bindingFluorescence-based ATP binding assays, mutation of key residues

    Methodological approaches for domain verification include:

    1. Expression of individual domains as soluble proteins

    2. Domain-specific activity assays to assess function

    3. Circular dichroism to confirm proper folding

    4. Limited proteolysis to identify domain boundaries

    5. X-ray crystallography or NMR studies of individual domains

    6. Cross-linking studies to identify interaction partners of specific domains

  • How can researchers optimize expression and purification protocols for Recombinant Salmonella paratyphi B Bifunctional protein aas?

    Optimization of expression and purification requires systematic testing of multiple conditions:

    Table 5: Expression and Purification Optimization Parameters

    ParameterVariables to TestEvaluation Method
    E. coli strainBL21(DE3), Rosetta, Arctic Express, SHuffleSDS-PAGE, Western blot for yield and solubility
    Culture mediumLB, TB, 2xYT, M9, AutoinductionGrowth curves, final OD600, protein yield
    Induction conditionsIPTG concentration (0.1-1.0 mM), temperature (16-37°C), duration (3-24h)SDS-PAGE for optimal expression level
    Cell lysisSonication, French press, chemical lysis, enzymatic lysisTotal protein recovery, activity preservation
    Purification strategyIMAC resins (Ni-NTA, Co-TALON), buffer conditions, imidazole gradientPurity by SDS-PAGE, yield quantification
    Tag removalTEV protease, Factor Xa, ThrombinCleavage efficiency, activity comparison

    Methodological considerations should include:

    1. Small-scale expression tests before scaling up

    2. Inclusion of protease inhibitors during purification

    3. Protein folding verification through circular dichroism or fluorescence assays

    4. Activity assays at each purification step to track specific activity

    5. Stability testing of the purified protein under various buffer conditions

  • What are the challenges and solutions in crystallizing Recombinant Salmonella paratyphi B Bifunctional protein aas for structural studies?

    Crystallizing large, multi-domain proteins like the 719-amino acid Bifunctional protein aas presents several challenges:

    Table 6: Crystallization Challenges and Methodological Solutions

    ChallengeDescriptionMethodological Solution
    Size and flexibilityLarge proteins with multiple domains often have flexible linkersExpress individual domains separately; use limited proteolysis to identify stable fragments
    Protein homogeneityHeterogeneous post-translational modifications or degradationSize exclusion chromatography as final purification step; mass spectrometry verification
    Buffer optimizationStandard storage buffers may not be ideal for crystallizationSystematic buffer screening with commercial crystallization kits; thermal shift assays for buffer stability
    His-tag interferenceN-terminal tag may prevent crystal contactsCompare crystallization with and without the tag; create constructs with cleavable tags
    Dynamic conformationsMultiple conformational states prevent lattice formationCo-crystallization with substrates, inhibitors, or binding partners to stabilize conformation

    Alternative structural biology approaches when crystallization proves challenging:

    1. Cryo-electron microscopy for large proteins or complexes

    2. Small angle X-ray scattering (SAXS) for low-resolution envelope determination

    3. Nuclear magnetic resonance (NMR) for structural studies of domains <25 kDa

    4. Hydrogen-deuterium exchange mass spectrometry for dynamics and domain organization

    5. Integrative structural biology combining multiple experimental approaches

  • How can Recombinant Salmonella paratyphi B Bifunctional protein aas be utilized in developing novel antimicrobial strategies?

    The bifunctional nature of the aas protein may present unique opportunities for antimicrobial development:

    Table 7: Antimicrobial Development Strategies Targeting aas

    ApproachRationaleMethodological Implementation
    Inhibitor screeningDisruption of aas function may impair bacterial survivalHigh-throughput screening of chemical libraries against purified aas protein activity
    Structure-based drug designKnowledge of active site architecture enables rational designMolecular docking of virtual compounds into predicted active sites
    Peptide mimeticsDesigning peptides that interfere with protein-protein interactionsPhage display to identify peptides that bind to aas interaction interfaces
    Combination approachesSynergistic effects with existing antibioticsCheckerboard assays to identify synergistic combinations of aas inhibitors with antibiotics
    Vaccine developmentaas as a potential antigenic targetImmunogenicity testing of recombinant aas in animal models

    Methodological considerations for evaluating potential antimicrobials:

    1. Development of robust activity assays for aas function

    2. Generation of conditional aas mutants to confirm essentiality

    3. Medicinal chemistry optimization of hit compounds

    4. Cell penetration studies for potential inhibitors

    5. Cytotoxicity testing against mammalian cell lines

    6. Animal model studies for promising candidates

  • What is the role of Salmonella paratyphi B Bifunctional protein aas in antimicrobial resistance, and how can this be experimentally investigated?

    While direct evidence for aas involvement in antimicrobial resistance is not established in the provided resources, methodological approaches to investigate potential connections include:

    Table 8: Experimental Approaches to Investigate aas in Antimicrobial Resistance

    ApproachDescriptionExpected Outcome
    Gene knockout studiesGenerate aas deletion mutants in resistant strainsDetermine if loss of aas affects resistance profiles
    Overexpression analysisExpress aas at elevated levels in susceptible strainsTest if overexpression confers increased resistance
    Comparative genomicsCompare aas sequences between resistant and susceptible isolatesIdentify potential resistance-associated mutations
    Transcriptional responseMeasure aas expression levels after antibiotic exposureDetermine if aas is part of stress response to antibiotics
    Protein-antibiotic interactionTest direct binding between purified aas and antibioticsIdentify if aas directly interacts with antibiotics

    Knowledge of multidrug resistance in Salmonella Paratyphi B lineages provides context: certain clones carry resistance-encoding genomic elements including Salmonella genomic island 1 (SGI-1) and class 2 integrons with multiple resistance genes . These genetic elements are particularly prevalent in the O:5 antigen negative lineage that dominates in poultry across Western Europe .

  • How can researchers design and implement protein-protein interaction studies to identify aas binding partners in Salmonella pathogenesis?

    Identifying protein-protein interactions involving aas requires a multi-technique approach:

    Table 9: Protein-Protein Interaction Methodologies for aas Research

    TechniqueExperimental DesignAdvantageLimitation
    Co-immunoprecipitationPull-down with anti-His antibodies from bacterial lysates expressing His-tagged aasPreserves native conditionsMay miss transient interactions
    Bacterial two-hybridConstruct fusion proteins with aas and potential partners linked to reporter componentsIn vivo detection in bacterial contextFalse positives from non-specific interactions
    Proximity labelingExpress aas fused to BioID or APEX2 in SalmonellaCaptures transient interactions in native environmentRequires genetic modification of bacteria
    Crosslinking mass spectrometryChemical crosslinking of protein complexes followed by MS identificationMaps interaction interfaces at amino acid resolutionComplex data analysis
    Surface plasmon resonanceImmobilize purified aas on sensor chip, flow potential partnersProvides binding kinetics and affinity constantsRequires purified potential partners

    For investigating aas interactions in the context of virulence, researchers should focus on potential interactions with:

    1. Components of Salmonella pathogenicity islands (SPIs)

    2. Type III secretion system (TTSS) proteins

    3. Regulatory proteins controlling virulence gene expression

    4. Host cell proteins during infection

    5. Components of antimicrobial resistance mechanisms

  • What are the evolutionary implications of comparative genomic analysis of aas across Salmonella paratyphi B lineages and other Salmonella serotypes?

    Comparative genomics approaches offer insights into the evolutionary history and functional specialization of aas:

    Table 10: Comparative Genomics Approaches for Evolutionary Analysis of aas

    Analysis TypeMethodologyEvolutionary Insight
    Sequence conservationMultiple sequence alignment across Salmonella serotypesIdentify universally conserved vs. lineage-specific regions
    Selection pressure analysisCalculate dN/dS ratios across coding sequenceDetect regions under positive or purifying selection
    Recombination detectionUse algorithms like Gubbins to identify recombination eventsDetermine if aas has undergone horizontal gene transfer
    Gene neighborhood analysisCompare genomic context of aas across lineagesIdentify operon structure conservation or reorganization
    Protein domain architectureCompare domain organization across serotypesDetect domain shuffling or acquisition events

    The existence of distinct lineages within Salmonella Paratyphi B with varying virulence profiles suggests potential functional diversification of proteins like aas. Particularly interesting would be comparisons between:

    1. The O:5 positive and O:5 negative lineages of Paratyphi B, which differ in virulence gene repertoires

    2. d-Tartrate fermenting (dT+) and non-fermenting variants, associated with different disease presentations

    3. PG1 lineage strongly associated with invasive disease versus other phylogenetic groups

    4. Paratyphi B lineages and other Salmonella serotypes to understand serotype-specific adaptations

  • How can functional genomics approaches be employed to understand the role of aas in Salmonella paratyphi B physiology and pathogenesis?

    Functional genomics offers comprehensive approaches to understand aas function:

    Table 11: Functional Genomics Strategies for aas Characterization

    ApproachExperimental DesignExpected Outcome
    Transcriptomics (RNA-Seq)Compare gene expression profiles between wild-type and aas mutantsIdentify regulatory networks involving aas
    Transposon sequencing (Tn-Seq)Create transposon library in aas mutant background and compare to wild-typeIdentify synthetic lethal interactions
    ProteomicsCompare protein abundance in wild-type versus aas mutantsIdentify post-transcriptional effects of aas deletion
    MetabolomicsProfile metabolite changes in aas mutantsConnect aas function to specific metabolic pathways
    CRISPR interferenceCreate CRISPRi library targeting genes in aas mutant backgroundIdentify genetic interactions with aas

    Implementation strategies should include:

    1. Creating precise deletion or conditional mutants of aas

    2. Testing mutant phenotypes under various stress conditions

    3. Performing infection models with mutants

    4. Complementation studies to confirm phenotypes

    5. Integration of multi-omics data using systems biology approaches

    This approach is particularly relevant given the distinct disease phenotypes associated with different Salmonella Paratyphi B lineages, ranging from serious systemic infections to self-limiting gastroenteritis .

  • What methodologies are most effective for studying the potential role of aas in biofilm formation and persistence in Salmonella paratyphi B?

    Biofilm formation is critical for bacterial persistence and antimicrobial resistance:

    Table 12: Methodologies for Studying aas in Biofilm Biology

    MethodologyExperimental DesignMeasurement Parameter
    Crystal violet assayCompare biofilm formation between wild-type and aas mutants in microplatesQuantitative biofilm biomass
    Confocal laser scanning microscopyFluorescently tag wild-type and mutant bacteria, visualize biofilm architecture3D structure, thickness, bacterial distribution
    Flow cell systemsGrow biofilms under continuous flow conditions with wild-type and mutantsDynamic formation, maturation, and dispersal
    Transcriptomics of biofilm cellsExtract RNA from biofilm vs. planktonic cells, compare aas expressionDifferential gene expression in biofilm state
    Mixed-species biofilmsCo-culture with relevant environmental or host microbiotaEcological interactions within biofilms

    Considering that certain Salmonella Paratyphi B lineages show persistence in specific environments, such as poultry production facilities in Western Europe , understanding aas contributions to biofilm formation could provide insights into:

    1. Environmental persistence mechanisms

    2. Resistance to disinfectants and antibiotics

    3. Host colonization strategies

    4. Survival on food processing surfaces

    5. Chronic infection establishment

  • How can researchers develop high-throughput screening assays to identify modulators of aas activity for potential therapeutic applications?

    Developing effective screening assays requires clear understanding of aas function:

    Table 13: High-Throughput Screening Assay Development for aas Modulators

    Assay TypeDesign PrincipleReadoutAdvantages
    Enzymatic activitySubstrate conversion assay based on predicted bifunctional activitiesFluorescence, absorbance, or luminescenceDirect functional measurement
    Thermal shiftMeasure protein stability changes upon compound bindingFluorescence from dye binding to hydrophobic regionsNo knowledge of substrate required
    Surface plasmon resonanceImmobilized aas exposed to compound librariesBinding kinetics and affinityDetailed binding information
    Cell-based reporterEngineer bacteria with reporter linked to aas-dependent pathwaysFluorescence or luminescenceTests compounds in cellular context
    Growth inhibitionTest compound effects on wild-type vs. aas overexpressing strainsOptical density measurementsDirect antimicrobial potential

    Implementation considerations include:

    1. Assay miniaturization to 384 or 1536-well format

    2. Validation with known modulators (if available)

    3. Optimization of signal-to-background ratio

    4. Development of counter-screens for false positives

    5. Secondary assays to confirm hits and determine mechanism of action

    Given the bifunctional nature of the protein, researchers should consider developing dual-readout assays that can distinguish effects on each function separately, providing insights into function-specific modulators with potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.