The full-length recombinant clsA protein spans 486 amino acids (1–486 aa) and includes an N-terminal His-tag for purification. Its sequence (partial excerpt below) reveals conserved motifs associated with phospholipase-D activity:
| Amino Acid Sequence Excerpt | Key Features |
|---|---|
MTTFYTVVSWLVILGYWVLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSVGE | N-terminal His-tag, hydrophobic regions for membrane association |
LQLLTDSDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRL | Catalytic domain with phospholipase-D motifs |
Source: Full sequence provided in .
Gene: clsA (SPAB_01504) encodes cardiolipin synthase A, a member of the phospholipase-D superfamily.
Function: Catalyzes the condensation of two phosphatidylglycerol (PG) molecules to form cardiolipin (CL), a critical phospholipid in bacterial membranes .
Redundancy: In Salmonella, CL biosynthesis involves three synthases (ClsA, ClsB, ClsC), with ClsA being predominant during logarithmic growth .
Recombinant clsA is produced in:
Cardiolipin Biosynthesis: ClsA’s role in CL production is critical for maintaining membrane stability during bacterial growth .
Trehalose Phospholipids: While unrelated to ClsA, ClsB in Salmonella produces immunostimulatory diPT (diphosphatidyltrehalose) .
Substrate Utilization: ClsA exclusively synthesizes CL from PG precursors, unlike ClsB, which produces trehalose phospholipids .
Growth Phase Dependency: ClsA activity peaks during logarithmic growth, whereas ClsB/C compensates under stress .
KEGG: spq:SPAB_01504
Cardiolipin synthase (cls) in Salmonella paratyphi B is an enzyme originally annotated for its role in cardiolipin biosynthesis. The protein contains characteristic phospholipase-D motifs and catalyzes the formation of cardiolipin, a key phospholipid in bacterial membranes. In Salmonella species, three cls enzymes (ClsA, ClsB, and ClsC) have been identified, each with distinct substrate preferences and activation conditions .
For optimal stability and activity retention of recombinant Salmonella paratyphi B Cardiolipin synthase, follow these research-validated protocols:
Storage conditions:
Store at -20°C for routine use or -80°C for extended storage
The protein is typically supplied in a Tris-based buffer with 50% glycerol
Shelf life: approximately 6 months at -20°C/-80°C in liquid form; 12 months in lyophilized form
Handling recommendations:
Avoid repeated freeze-thaw cycles as they significantly reduce enzymatic activity
For working aliquots, store at 4°C for no more than one week
When reconstituting lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL
For long-term storage after reconstitution, add glycerol to a final concentration of 5-50% and aliquot before storing at -20°C/-80°C
Following these guidelines will help maintain the structural integrity and enzymatic activity of the recombinant protein for experimental applications.
Several validated methods can be employed to assess the enzymatic activity of recombinant Cardiolipin synthase from Salmonella paratyphi B:
Thin-Layer Chromatography (TLC) Analysis:
Extract lipids from reaction mixtures using chloroform:methanol (2:1 v/v)
Separate lipids on silica TLC plates using appropriate solvent systems
Visualize with iodine vapor, phosphomolybdic acid, or other lipid-specific stains
Catalytic Activity Assays:
Measure the consumption of substrate phospholipids (phosphatidylglycerol)
Quantify cardiolipin production using mass spectrometry
Monitor changes in fluorescently labeled phospholipid substrates
Functional Complementation:
Express the cls gene in cls-deficient bacteria
Verify restoration of cardiolipin production by lipid extraction and analysis
Compare with known catalytically inactive mutants (e.g., clsBH290A has been shown to be catalytically inert)
For enzymes suspected of having dual functions (like ClsB's role in trehalose phospholipid synthesis), specialized assays may be necessary to detect alternative reaction products.
Generating cardiolipin synthase mutants in Salmonella requires careful genetic manipulation to ensure specific gene disruption without polar effects on adjacent genes. Based on published methodologies, the following approach is recommended:
Single Gene Deletion Method:
Use lambda Red recombination system for precise gene replacement
Design primers with 40-bp homology to regions flanking the target cls gene
Replace the target gene with an antibiotic resistance cassette
Verify deletion by PCR and sequencing
Remove the antibiotic cassette using FLP recombinase if needed for multiple mutations
Multiple Gene Deletion Strategy:
For generating double (ΔclsAB, ΔclsBC, ΔclsAC) and triple mutants (ΔclsABC):
Use sequential deletion with different antibiotic markers
Alternatively, use marker-less deletion methods with counterselection
Verify each deletion step by PCR and phenotypic analysis
Confirm lipid profile alterations by thin-layer chromatography
Complementation Testing:
Clone wild-type cls genes into low or medium-copy plasmids
Transform cls-deficient mutants with complementation plasmids
Assess restoration of cardiolipin production
Generate site-directed mutants (e.g., ClsBH290A) to test catalytic activity requirements
This approach has been successfully employed to create a complete set of cls gene mutants in S. Typhimurium, enabling detailed functional analysis.
Purification of recombinant Cardiolipin synthase presents challenges due to its membrane-associated properties. Based on successful approaches in the literature, the following purification strategy is recommended:
Expression System Selection:
E. coli is the preferred heterologous expression system for Salmonella paratyphi B Cardiolipin synthase
BL21(DE3) or similar strains are recommended for high-level expression
Use expression vectors with inducible promoters (T7, tac) for controlled expression
Solubilization and Extraction:
Harvest cells and disrupt by sonication or pressure homogenization
Isolate membrane fractions by ultracentrifugation
Solubilize membrane proteins using mild detergents (n-dodecyl-β-D-maltoside, CHAPS, or Triton X-100)
Optimize detergent concentration to maintain enzymatic activity
Affinity Purification:
Express the protein with affinity tags (His-tag, GST-tag, etc.)
Purify using appropriate affinity chromatography
Include detergents in all buffers to maintain protein solubility
Perform on-column washing with detergent-containing buffers
Elute with appropriate competitors (imidazole for His-tagged proteins)
Verify purity by SDS-PAGE (>85% purity is typically achievable)
Additional Purification Steps:
Size exclusion chromatography to remove aggregates
Ion exchange chromatography for further purification
Concentrate using ultrafiltration with detergent above critical micelle concentration
Following this protocol can yield functional recombinant Cardiolipin synthase suitable for enzymatic and structural studies.
Salmonella species possess three distinct cardiolipin synthases that differ in substrate specificity, regulation, and physiological roles:
ClsA (Primary Cardiolipin Synthase):
Predominant synthase during logarithmic growth
Uses two phosphatidylglycerol (PGl) molecules as substrates to produce one cardiolipin molecule
Expressed constitutively during normal growth conditions
Has the highest activity for cardiolipin synthesis under standard conditions
ClsB (Dual-Function Enzyme):
Initially annotated as a cardiolipin synthase but has broader substrate specificity
Can synthesize cardiolipin from two PGl molecules
Uniquely capable of synthesizing phosphatidyltrehalose (PT) and diphosphatidyltrehalose (diPT)
Activated during stationary phase and stress conditions
Essential for trehalose phospholipid biosynthesis
Demonstrates promiscuous enzymatic activity that can synthesize phosphatidylalcohols
ClsC (Stress-Activated Synthase):
Utilizes phosphatidylethanolamine (PE) and phosphatidylglycerol (PGl) as substrates
Contributes to the cardiolipin pool primarily during stress conditions
Activated during stationary phase and high osmolarity conditions
Functions in a complementary manner with the other synthases
These enzymes exhibit functional redundancy while also providing biochemical flexibility that allows Salmonella to modulate membrane composition under different environmental conditions, which may be crucial for adaptation during infection.
The relationship between cardiolipin synthase activity and Salmonella pathogenesis reveals surprising complexity:
Intracellular Survival and Inflammasome Activation:
Single mutants (ΔclsA, ΔclsB, ΔclsC) and some double mutants (ΔclsAC) behave like wild-type in macrophage infection models
Other double mutants (ΔclsAB, ΔclsBC) and triple mutants (ΔclsABC) show attenuated intracellular survival
Mutants lacking specific cls gene combinations elicit reduced secretion of inflammatory cytokines IL-1β and IL-18, suggesting altered inflammasome activation
When both clsA and clsC are deleted, clsB becomes necessary and sufficient for intracellular survival
Similarly, when clsB is deleted, clsA and clsC together become necessary and sufficient for proper function
Virulence in Mouse Models:
Functional Redundancy vs. Distinct Roles:
The three cls genes show cooperative and redundant influence on inflammasome activation
Expressing clsA or clsB in trans in the triple mutant restores cardiolipin production but does not rescue macrophage phenotypes
This indicates that the observed phenotypes are not directly caused by alterations in cardiolipin content but may involve other functions of these enzymes
This complex relationship highlights the multifunctional nature of cardiolipin synthases and suggests they may have roles beyond their enzymatic activity in phospholipid biosynthesis.
The role of ClsB in trehalose phospholipid biosynthesis represents a significant case of functional misannotation in bacterial genomics:
Discovery of Trehalose Phospholipids:
Research comparing lipidomes of Salmonella Paratyphi and S. Typhi led to the discovery of previously unknown trehalose phospholipids: 6-phosphatidyltrehalose (PT) and 6,6′-diphosphatidyltrehalose (diPT)
These compounds were found to be enriched in S. Typhi, which causes typhoid fever
Functional Reannotation of ClsB:
Systematic gene knockout experiments revealed that clsB, previously annotated as one of three cardiolipin synthases, was essential for trehalose phospholipid biosynthesis
This led to the proposal that ClsB is actually a PT and diPT synthase rather than simply a cardiolipin synthase
This highlights the issue of poor annotation and propagation of errors in bacterial genome databases
Structural and Functional Analysis:
ClsB shares the phospholipase-D motif characteristic of cardiolipin synthases
Despite this structural similarity, it demonstrates substrate promiscuity, being able to catalyze the formation of cardiolipin, phosphatidylalcohols, PT, and diPT
The enzyme can still produce cardiolipin from two phosphatidylglycerol molecules but has evolved additional functionalities
Phylogenetic Distribution:
DiPT production is restricted to a subset of Gram-negative bacteria
Large amounts are produced by S. Typhi, with lower amounts by other pathogens
Variable amounts are synthesized by Escherichia coli strains
"Chemotyping" (direct measurement of diPT production) proved more accurate than clsB homology analysis for predicting this function
Immunological Significance:
DiPT activates Mincle, a macrophage activating receptor that also recognizes mycobacterial cord factor (6,6′-trehalose dimycolate)
This represents convergent function between Gram-negative bacteria and mycobacteria
These compounds may play important roles in host-pathogen interactions
This case illustrates how experimental validation of enzyme function can reveal unexpected roles that significantly impact our understanding of bacterial pathogenesis and immune interactions.
The impact of cardiolipin synthase mutations on membrane composition and bacterial stress responses involves complex compensatory mechanisms:
Membrane Lipid Remodeling:
Deletion of individual cls genes leads to compensatory increases in activity of remaining synthases
Total cardiolipin levels may be maintained despite loss of one or two synthases
Triple mutants (ΔclsABC) show complete absence of cardiolipin with corresponding increases in precursor phospholipids (phosphatidylglycerol)
Changes in membrane phospholipid composition can alter membrane fluidity, curvature, and protein organization
Stress Response Modulation:
Cardiolipin is enriched at cell poles and division sites, suggesting roles in cell division
Loss of cardiolipin may affect bacterial response to:
Osmotic stress
pH fluctuations
Antimicrobial peptides
Temperature variations
Defects in cls genes may alter expression of stress response regulons through membrane sensing mechanisms
Redox Balance and Energy Metabolism:
Cardiolipin interacts with respiratory chain complexes in the membrane
Alterations in cardiolipin content may affect electron transport and ATP generation
This can influence bacterial growth rates under nutrient limitation or oxidative stress conditions
Experimental approaches to study these effects include:
Membrane fluidity measurements using fluorescence anisotropy
Lipidomic profiling under various stress conditions
Transcriptomic analysis to identify compensatory gene expression changes
Electron microscopy to examine membrane ultrastructure
These findings highlight the remarkable adaptability of bacterial membrane systems and the complex interplay between lipid composition and stress responses.
The observed contradiction between in vitro attenuation of cardiolipin synthase mutants in macrophages and their retained virulence in mouse models presents an intriguing research puzzle that can be approached with several sophisticated methodologies:
Advanced In Vivo Imaging Techniques:
Utilize bioluminescent or fluorescent reporter strains of cls mutants
Track bacterial distribution and replication in real-time in live animals
Compare tissue tropism and growth kinetics between wild-type and mutant strains
Correlate with inflammatory responses using dual-reporter systems
Cell Type-Specific Host Interactions:
Examine cls mutant interactions with different host cell types beyond macrophages (epithelial cells, neutrophils, dendritic cells)
Use ex vivo tissue cultures or organoids to better mimic in vivo complexity
Employ flow cytometry-based approaches to quantify bacterial association with specific cell populations from infected tissues
Compensatory Mechanisms Analysis:
Perform transcriptomic analysis of cls mutants during in vivo infection versus in vitro macrophage culture
Identify differentially expressed genes that might compensate for cls deficiency in vivo
Use transposon mutagenesis screens to identify genetic suppressors that restore in vitro fitness
Host Response Profiling:
Compare host immune responses to wild-type and cls mutants using cytokine profiling
Examine inflammasome activation in various tissues, not just cultured macrophages
Use immunodeficient mouse models to determine if specific immune pathways mask the importance of cls genes in vivo
Alternative Infection Routes:
Test different infection routes (oral, intravenous, intraperitoneal) to determine if mode of entry affects the requirement for cls genes
Examine competitive indices between wild-type and mutant strains in mixed infections
Extend the timeline of infection studies to capture potential differences in persistence
Metabolic Environment Consideration:
Compare growth media used in vitro with in vivo metabolite availability
Supplement in vitro conditions with host-derived factors
Conduct metabolomic analysis of infected tissues versus culture media
By systematically applying these approaches, researchers can identify the contextual factors that explain why cardiolipin synthase activity appears critical in isolated macrophages but dispensable in the complex in vivo environment.
Understanding the structural basis for ClsB's substrate promiscuity requires sophisticated structural biology approaches. The following methodologies can provide critical insights into how this enzyme accommodates different substrates:
X-ray Crystallography of ClsB:
Express and purify ClsB with appropriate detergents to maintain native conformation
Attempt co-crystallization with various substrates (phosphatidylglycerol, trehalose)
Analyze substrate binding pockets and catalytic sites
Compare with structures of ClsA and ClsC to identify unique features
Focus on resolving the active site architecture to understand the molecular basis of promiscuity
Cryo-Electron Microscopy:
Visualize ClsB in different conformational states
Study the enzyme in membrane-mimetic environments (nanodiscs, liposomes)
Capture enzyme-substrate complexes in near-native conditions
Generate 3D reconstructions to analyze conformational changes upon substrate binding
Molecular Dynamics Simulations:
Use the amino acid sequence to model ClsB structure based on homologous proteins
Simulate substrate docking and enzyme flexibility
Predict binding energy differences between various substrates
Model transition states to understand catalytic mechanism variations
Site-Directed Mutagenesis and Structure-Function Analysis:
Identify conserved residues across cardiolipin synthases
Create point mutations at predicted substrate-binding sites
Test activity against different substrates to map specificity-determining residues
The catalytically inactive ClsBH290A mutant provides a starting point for such analyses
Hydrogen-Deuterium Exchange Mass Spectrometry:
Analyze conformational dynamics of ClsB with different substrates
Identify regions with differential solvent accessibility
Map substrate-induced conformational changes
Compare dynamics between wild-type and mutant variants
Small-Angle X-ray Scattering (SAXS):
Obtain low-resolution envelopes of ClsB in solution
Compare conformational states with different substrates
Analyze oligomerization state changes upon substrate binding
These approaches, used in combination, can provide a comprehensive understanding of the structural features that enable ClsB to catalyze multiple reactions with different substrates, explaining its dual role in cardiolipin and trehalose phospholipid biosynthesis.
The discovery of trehalose phospholipids synthesized by ClsB opens new avenues in understanding host-pathogen interactions and potential vaccine development:
Immunomodulatory Properties:
Diphosphatidyltrehalose (diPT) activates Mincle, a C-type lectin receptor on macrophages
This represents convergent evolution with mycobacterial cord factor (trehalose dimycolate), a potent immunostimulant
Activation of Mincle can trigger pro-inflammatory responses, potentially influencing infection outcomes
These compounds may serve as pathogen-associated molecular patterns (PAMPs)
Differential Expression Across Pathogens:
S. Typhi produces large amounts of diPT, while other pathogens produce lower amounts
This differential expression may contribute to pathogen-specific immune responses
Expression patterns correlate with particular disease manifestations (e.g., typhoid fever)
Understanding this variation could help explain serovar-specific pathogenicity
Potential as Vaccine Adjuvants:
Given their immunostimulatory properties, synthetic trehalose phospholipids could be developed as adjuvants
Their structural similarity to established adjuvants like trehalose dimycolate suggests potential utility
Chemical synthesis methods have been established, allowing for structure-activity relationship studies
Modified versions could be engineered for enhanced adjuvant properties with reduced toxicity
Biomarker Applications:
The presence of trehalose phospholipids could serve as biomarkers for specific infections
Diagnostic tests could be developed to detect these compounds in patient samples
This may allow rapid differentiation between Salmonella serovars with different clinical implications
Therapeutic Targeting:
Inhibitors of ClsB could potentially attenuate virulence
Such inhibitors might have selective activity against pathogens that rely on trehalose phospholipids
Structure-based drug design could utilize the unique features of ClsB for targeted therapeutics
These findings highlight how the reannotation of a single enzyme can open multiple new research directions with significant translational potential.
Advanced lipidomic approaches are crucial for fully understanding bacterial membrane adaptations during infection. The following methodological improvements can enhance this research area:
In Vivo Extraction and Analysis:
Develop methods to extract bacterial lipids directly from infected tissues
Employ stable isotope labeling to distinguish bacterial from host lipids
Implement tissue-clearing techniques compatible with lipid preservation
Combine with spatial transcriptomics to correlate lipid profiles with gene expression patterns
Single-Cell Lipidomics:
Adapt mass spectrometry imaging for single bacterial cell analysis
Develop fluorescent probes for specific lipid classes to enable live-cell imaging
Use microfluidic approaches to analyze lipids from individual bacteria isolated from infection sites
Correlate single-cell lipid profiles with bacterial transcriptomes and proteomes
Temporal Resolution of Lipid Dynamics:
Implement pulse-chase labeling with isotope-labeled precursors to track lipid turnover
Develop time-resolved sampling methods for infection models
Use biosensors to monitor membrane properties in real-time during infection
Correlate lipid changes with stages of pathogenesis (adherence, invasion, replication)
Functional Lipidomics:
Couple lipid profiling with phenotypic assays to determine functional consequences
Use synthetic biology approaches to engineer bacteria with defined lipid compositions
Develop CRISPR-based screens targeting lipid biosynthesis genes
Create reporter systems that respond to membrane property changes
Advanced Analytical Platforms:
Implement ion mobility mass spectrometry for improved separation of lipid isomers
Utilize high-resolution mass spectrometry for comprehensive lipidome characterization
Develop machine learning algorithms for automated lipid identification and quantification
Create standardized workflows and databases specific for bacterial lipids
Host-Pathogen Lipid Interactions:
Analyze lipid exchange between bacteria and host membranes
Investigate how bacterial lipids modulate host membrane properties and signaling
Study the role of lipid rafts in bacteria-host interactions
Examine how host lipids are incorporated into or modify bacterial membranes
These methodological advances would significantly enhance our ability to understand the complex lipid adaptations that occur during bacterial infections and could reveal new targets for therapeutic intervention.
Improving functional annotation of lipid-modifying enzymes in bacterial genomes requires sophisticated computational approaches to overcome current limitations, as highlighted by the ClsB misannotation case:
Advanced Homology Detection Methods:
Implement profile hidden Markov models (HMMs) specific for lipid-modifying enzyme families
Develop position-specific scoring matrices that account for catalytic residues
Use deep learning approaches to detect remote homologies missed by conventional methods
Incorporate evolutionary coupling analysis to identify co-evolving residues critical for function
Substrate Specificity Prediction:
Develop machine learning algorithms trained on experimentally validated enzyme-substrate pairs
Identify substrate-determining regions through comparative analysis of related enzymes
Implement active site architecture analysis for substrate compatibility
Create metabolic context-aware annotation that considers available substrates in a given organism
Integration of Structural Information:
Apply AlphaFold or RoseTTAFold to predict structures of putative lipid-modifying enzymes
Conduct virtual screening of potential substrates against predicted structures
Identify key structural motifs that differentiate between related enzyme functions
Metabolic Context Analysis:
Consider genomic context and operon structure in functional predictions
Implement metabolic pathway gap analysis to identify missing enzymatic functions
Use correlated gene presence/absence patterns across species to infer functional relationships
Apply flux balance analysis to test feasibility of predicted lipid biosynthesis pathways
Automated Literature Mining:
Develop natural language processing tools to extract experimental evidence for enzyme functions
Create knowledge graphs connecting genes, proteins, substrates, and phenotypes
Implement systems for propagating experimental corrections to existing annotations
Develop confidence scoring for functional annotations based on available evidence
Community Curation and Validation:
Create platforms for expert curation of lipid-modifying enzyme annotations
Implement systems for flagging potentially misannotated enzymes
Develop metrics for annotation quality assessment
Establish standardized experimental validation protocols for computational predictions
By implementing these approaches, researchers could significantly improve the accuracy of functional annotations for lipid-modifying enzymes like cardiolipin synthases, reducing the propagation of annotation errors that currently hinder research progress.
Based on current findings and knowledge gaps, several promising research directions for cardiolipin synthase in bacterial pathogens emerge:
Clarification of Specialized Functions:
Further investigation of the differentiated roles of ClsA, ClsB, and ClsC in various bacterial species
Comprehensive examination of substrate ranges for each enzyme under different physiological conditions
Investigation of potential moonlighting functions beyond lipid synthesis
Exploration of potential roles in prokaryotic organelle organization and function
Host-Pathogen Interface Exploration:
Further characterization of how cardiolipin and trehalose phospholipids interact with host immune receptors
Investigation of temporal changes in lipid composition during different infection stages
Examination of cardiolipin-dependent membrane domains in bacterial adaptation to host environments
Study of cardiolipin's role in antibiotic resistance mechanisms
Therapeutic Target Development:
Design of specific inhibitors targeting ClsB's trehalose phospholipid synthesis capability
Exploration of cardiolipin synthesis inhibition as an antivirulence strategy
Development of compounds that disrupt cardiolipin-dependent membrane organization
Creation of diagnostic tools based on lipid profiles to identify specific pathogens
Structural Biology Advances:
Resolution of crystal structures for all three cardiolipin synthases
Comparative analysis of enzyme-substrate interactions across different bacterial species
Investigation of potential protein-protein interactions involving cardiolipin synthases
Examination of regulatory mechanisms controlling enzyme activity and expression
System-Level Understanding:
Integration of lipidomics, transcriptomics, and proteomics to develop comprehensive models of membrane adaptation
Exploration of cardiolipin's role in bacterial stress response networks
Investigation of evolutionary trajectories of cardiolipin synthase diversification
Development of synthetic biology approaches to engineer membrane composition