Recombinant Salmonella paratyphi B Cobalamin biosynthesis protein CbiB (cbiB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cobalamin Biosynthesis

CbiB catalyzes the ATP-dependent phosphorylation of AdoCby, activating it for subsequent amide bond formation with ethanolamine-phosphate (EA-P) or aminopropanol-phosphate (AP-P) . Key mechanistic insights:

  • Membrane Localization: CbiB is an integral inner membrane protein with five predicted transmembrane domains. Critical residues (e.g., D181) face the periplasm, suggesting interactions with other membrane-bound enzymes .

  • Substrate Flexibility:

    • Preferentially uses AP-P under physiological conditions .

    • Utilizes EA-P in cobD mutants (lacking l-Thr-P decarboxylase), producing norcobalamin (lacking the C176 methyl group) .

  • Enzyme Activity: Acts as a synthetase, phosphorylating AdoCby to form AdoCby-P, which drives amide bond formation .

3.1. Genetic and Biochemical Evidence

  • Complementation Studies: Overexpression of cbiB restored cobalamin synthesis in Salmonella strains lacking CobU or CobD enzymes, confirming its role in salvaging cobinamide (Cbi) .

  • Substrate Salvaging:

    • In cobU ycfN mutants, CbiB phosphorylates Cbi directly, enabling its conversion to adenosylcobinamide-GDP via archaeal CobY .

    • EA-P supplementation in cobD mutants bypassed the need for AP-P, yielding norcobalamin detectable via RP-HPLC and mass spectrometry .

Applications and Research Tools

  • Enzyme Mechanism Studies: Used to investigate phosphorylation-dependent activation in corrinoid biosynthesis .

  • Biotechnological Relevance: Recombinant CbiB serves as a tool for engineering vitamin B₁₂ pathways in non-native hosts .

  • Diagnostic Use: Commercial ELISA kits (e.g., CSB-CF429515STF) utilize recombinant CbiB for antibody production and biomarker detection .

Comparative Analysis of CbiB Orthologs

SpeciesProtein LengthHost SystemPurityKey Feature
S. paratyphi B1–93 aa E. coli≥90%Full-length, His-tagged
S. paratyphi APartial E. coli/Yeast≥85%Cobalamin biosynthesis
Pyrococcus abyssiPartial Baculovirus≥85%CobD/CbiB family ortholog

Challenges and Future Directions

  • Protein Solubility: Difficulty in isolating functional CbiB for in vitro assays remains a barrier .

  • Multiprotein Complexes: Hypothesized interactions with BtuCD transporters and CobS synthetase warrant further study .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
cbiB; SPAB_01071; Cobalamin biosynthesis protein CbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
cbiB
Target Protein Sequence
MTILAWCIAWVLDFIIGDPQHWPHPVRWIGRLITFVQRIVRRYCPGDKALRIGGGVMWVV VVGATWGVAWGVLALAQRIHPWFGWSVEVWMIFTTLAGRSLARAAQEVERPLRENDLAES RIKLSWIVGRDTSQLQPAQINRGVVETVAENTVDGIIAPLFFLFLGGAPLAMAYKAVNTL DSMVGYKHEKYRAIGMVSARMDDVANYLPARLSWLLLGIAAGLCRLSGWRALRIGWRDRY NHSSPNCAWSEACVAGALGIQLGGPNNYFGERVDKPWIGDAQRDISVDDISRTIRLMWVA STLALALFIAARCGLSGVA
Uniprot No.

Target Background

Function

CbiB catalyzes the conversion of cobyric acid to cobinamide by adding aminopropanol to the F carboxylic group. However, the actual cosubstrate may be (R)-1-amino-2-propanol O-2-phosphate, resulting in cobinamide phosphate.

Database Links
Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of Cobalamin biosynthesis protein CbiB in Salmonella paratyphi B?

Cobalamin biosynthesis protein CbiB (cbiB) in Salmonella paratyphi B is a critical enzyme involved in the de novo synthesis pathway of vitamin B12 (cobalamin). The protein functions as a cobalt-precorrin-8 methylmutase, catalyzing an essential step in the anaerobic pathway of cobalamin biosynthesis . This process is particularly important for S. paratyphi B virulence, as cobalamin plays roles in various metabolic pathways that enable the pathogen to survive in nutrient-limited host environments. The functional protein contains 319 amino acids and is integrated into the bacterial membrane where it participates in the biosynthetic pathway .

How does the structure of Salmonella paratyphi B CbiB differ from other Salmonella species?

The CbiB protein from Salmonella paratyphi B shares significant homology with CbiB proteins from other Salmonella species. For example, it has high sequence similarity with Salmonella arizonae CbiB, which consists of 319 amino acids with characteristic transmembrane domains . Comparative genomic analysis indicates that while the core functional domains of CbiB are conserved across Salmonella serovars, there may be subtle variations in non-catalytic regions that could influence protein stability or regulatory interactions. The specific sequence from S. arizonae CbiB (MTILAWCIAWVLDFIIGDPQHWPHPVRWIGRLITFVQHIVRRYCHSDKALRIGGGVMWIVVVGATWGMAWGVLALAQRIHPWLGWSVEVWMIFTVLAGRSLARAAQDVERPLRENDLAESRIKLSWIVGRDTSQLQPEQINRAVVETVAENTVDGIIAPLFFLFLGGAPLAMAYKAVNTLDSMVGYKHEKYRAIGMVSARMDDVANYLPARLSWLLLGIAAGLCRLSGWRALRIGWRDRYWHSSPNCAWSEACVAGALGIQLGGPNNYFGERVDKPWIGDAQRDISVDDISRTIRLMWGASTLALALFIAARCWLSGVA) provides a reference point for structural studies of S. paratyphi B CbiB .

Why is recombinant CbiB important for Salmonella paratyphi B research?

Recombinant CbiB from S. paratyphi B serves as a valuable research tool for multiple scientific objectives. Primarily, it enables detailed structure-function studies of the protein without the need to handle pathogenic strains directly. The purified recombinant protein facilitates:

  • Crystal structure determination and structural biology analyses

  • Vaccine development research, as metabolic pathways involving CbiB may represent targets for attenuation strategies

  • Investigation of antimicrobial compounds targeting cobalamin biosynthesis

  • Studies on the evolutionary relationships between different Salmonella serovars

The development of a live attenuated S. paratyphi B vaccine strain (CVD 2005) demonstrates the practical application of such research, where understanding metabolic proteins like CbiB contributes to vaccine strategies .

What expression systems are optimal for producing recombinant S. paratyphi B CbiB protein?

For optimal expression of recombinant S. paratyphi B CbiB protein, Escherichia coli-based expression systems have demonstrated significant efficacy . The following table summarizes recommended expression systems with their advantages and limitations:

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coli BL21(DE3)High yield, cost-effective, rapid growthMay form inclusion bodies, lacks post-translational modificationsInduction: 0.5mM IPTG, 25°C, 16h
E. coli Rosetta 2(DE3)Enhanced expression of proteins with rare codonsHigher cost than standard strainsInduction: 0.3mM IPTG, 20°C, 18h
E. coli SHuffleImproved disulfide bond formationLower yield than BL21Induction: 0.1mM IPTG, 16°C, 24h

For membrane proteins like CbiB, expression vectors containing N-terminal His-tags facilitate purification while maintaining protein functionality . Design of experiments (DoE) approaches are strongly recommended for optimizing expression conditions, as they efficiently identify optimal combinations of factors such as temperature, inducer concentration, and expression time .

How can Design of Experiments (DoE) be applied to optimize CbiB protein production?

Design of Experiments (DoE) offers a systematic approach to optimize recombinant CbiB protein production by simultaneously evaluating multiple factors affecting expression and purification . When applied to CbiB production, researchers should:

  • Identify critical factors affecting protein yield and solubility:

    • Induction temperature (typically 16-37°C)

    • IPTG concentration (0.1-1.0 mM)

    • Post-induction time (4-24 hours)

    • Media composition (LB, TB, minimal media)

    • Cell density at induction (OD600 0.4-1.0)

  • Select an appropriate DoE model:

    • Factorial designs for screening experiments

    • Response surface methodology (RSM) for optimization

    • Central composite designs for detailed process mapping

  • Develop a response variable measurement:

    • Protein yield (mg/L culture)

    • Solubility percentage

    • Functional activity assay specific to CbiB

A typical optimization workflow would begin with a fractional factorial design to identify significant factors, followed by RSM to determine optimal conditions. This approach has been demonstrated to significantly reduce the number of experiments required while achieving superior results compared to traditional one-factor-at-a-time optimization methods .

What purification strategies yield high-purity recombinant CbiB protein?

Purification of recombinant CbiB presents challenges due to its membrane-associated nature. A multi-step purification strategy is recommended:

  • Initial extraction and solubilization:

    • Membrane fraction isolation via ultracentrifugation

    • Solubilization using mild detergents (DDM, LDAO, or C12E8)

    • Buffer optimization (pH 7.5-8.0, 150-300 mM NaCl)

  • Primary purification using affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged CbiB

    • Gradual imidazole elution (50-500 mM) to separate non-specific binding proteins

  • Secondary purification steps:

    • Size exclusion chromatography to remove aggregates and impurities

    • Ion exchange chromatography for further polishing

  • Quality assessment:

    • SDS-PAGE analysis (target purity >90%)

    • Western blot confirmation

    • Mass spectrometry validation

The purified protein should be stored in a stabilizing buffer containing 6% trehalose at pH 8.0 to maintain long-term stability . Aliquoting and storage at -80°C is strongly recommended to prevent repeated freeze-thaw cycles.

How can recombinant CbiB be used to study S. paratyphi B virulence mechanisms?

Recombinant CbiB protein serves as a powerful tool for investigating S. paratyphi B virulence mechanisms through several sophisticated approaches:

  • Gene knockout and complementation studies:

    • Construction of ΔcbiB deletion mutants

    • Phenotypic characterization under various growth conditions

    • Complementation with recombinant CbiB to confirm phenotype restoration

  • Protein-protein interaction mapping:

    • Pull-down assays using purified recombinant CbiB to identify interaction partners

    • Bacterial two-hybrid screening for genetic confirmation

    • Cross-linking mass spectrometry to identify proximity relationships

  • Host-pathogen interaction studies:

    • Evaluation of CbiB's role in intracellular survival within macrophages

    • Assessment of CbiB's contribution to nutritional immunity evasion

    • Investigation of potential immunomodulatory effects

Comparison of clinical isolates from Chilean enteric fever-associated strains has demonstrated that genomic differences between Paratyphi B sensu stricto and Java variants, potentially including variations in the cbiB gene region, may contribute to their differing disease presentations . This suggests that CbiB could play a role in determining the invasive versus gastroenteritis-associated phenotypes of different S. paratyphi B variants.

What are the challenges in developing antibodies against S. paratyphi B CbiB?

Developing high-specificity antibodies against S. paratyphi B CbiB presents several technical challenges:

  • Antigenicity limitations:

    • Membrane proteins like CbiB often have limited exposed epitopes

    • Conserved regions may induce cross-reactivity with other bacterial species

    • Conformational epitopes may be lost in recombinant protein preparations

  • Immunization strategies for optimal responses:

    • Peptide-based approaches targeting unique exposed regions

    • DNA immunization followed by protein boosting

    • Liposome-reconstituted CbiB to preserve native conformation

  • Validation challenges:

    • Limited availability of Paratyphi B strains for specificity testing

    • Need for extensive cross-reactivity testing with other Salmonella serovars

    • Verification of antibody utility in multiple applications (Western blot, ELISA, immunofluorescence)

When developing antibodies, researchers should consider using the recombinant His-tagged CbiB protein as an immunogen, while carefully selecting peptide regions unique to S. paratyphi B to minimize cross-reactivity . Collaboration with specialized bioinformatics platforms like CBiB Bordeaux can facilitate epitope prediction and analysis of antigenic determinants .

How does CbiB function differ between Paratyphi B sensu stricto and Paratyphi B Java variants?

The functional differences in CbiB between Paratyphi B sensu stricto (associated with enteric fever) and Paratyphi B Java (associated with gastroenteritis) represent an important area of investigation:

  • Genomic comparison findings:

    • Comparative genomic studies of Chilean clinical isolates revealed genetic differences between these variants

    • While specific CbiB variations were not highlighted, the study identified genomic loci that differ between the variants, potentially affecting metabolic pathways including cobalamin biosynthesis

  • Metabolic implications:

    • Cobalamin biosynthesis may contribute differently to pathogen survival in various host environments

    • Sensu stricto variants may utilize CbiB-dependent pathways for persistent systemic infection

    • Java variants might exhibit altered regulation or activity of CbiB related to intestinal colonization

  • Experimental approaches to characterize differences:

    • Enzymatic activity assays comparing recombinant CbiB from both variants

    • Gene expression analysis under conditions mimicking different infection sites

    • Structural studies to identify variant-specific conformational differences

Understanding these differences has practical applications, as demonstrated by the development of the CVD 2005 vaccine strain, which provided protection against both Paratyphi B sensu stricto and Java variants in mouse models .

What is the potential of CbiB as a target for vaccine development against S. paratyphi B?

CbiB represents a potentially valuable target for vaccine development against S. paratyphi B for several compelling reasons:

  • Metabolic significance:

    • Essential role in cobalamin biosynthesis pathway

    • Required for optimal virulence and in vivo survival

    • Disruption may attenuate pathogen without complete growth inhibition

  • Current vaccine development status:

    • The experimental vaccine strain CVD 2005 demonstrates proof-of-concept for targeting metabolic pathways in S. paratyphi B

    • This live attenuated vaccine provided protection against both sensu stricto and Java variants in mouse models

    • Despite these advances, no commercially available vaccine exists specifically for S. paratyphi B

  • Advantages as a vaccine component:

    • Conserved across Salmonella strains but with sufficient variability for specificity

    • Potential for cross-protection against multiple variants

    • Could complement existing approaches targeting other enteric fever serovars

The development of vaccines against S. paratyphi B becomes increasingly important as emerging conjugate vaccines against other enteric fever serovars (Typhi, Paratyphi A) may create an ecological niche that could be filled by S. paratyphi B . A trivalent vaccine formulation including protection against S. paratyphi B would provide more comprehensive coverage against enteric fever.

How do recombinant CbiB protein studies complement genomic approaches in S. paratyphi B research?

The integration of recombinant protein studies with genomic approaches creates a synergistic research strategy for S. paratyphi B investigations:

  • Complementary methodological strengths:

    • Genomic approaches identify genetic variations between strains and serovars

    • Recombinant protein studies provide functional validation of genomic findings

    • Combined approaches link genotype to phenotype more effectively than either alone

  • Practical research applications:

    • Sequencing of 38 enteric fever-associated strains from Chile provided genetic context

    • Functional characterization of proteins like CbiB validates the relevance of identified genetic differences

    • Protein-level studies can identify post-transcriptional regulatory mechanisms missed by genomic approaches

  • Bioinformatic integration platforms:

    • Specialized bioinformatics platforms like CBiB Bordeaux offer expertise in data integration

    • Analysis workflows combining genomic data with protein function predictions

    • Machine learning approaches to predict functional consequences of genetic variations

This integrated approach has already yielded valuable insights, as demonstrated by research showing that despite genomic differences between Paratyphi B sensu stricto and Java variants, a vaccine based on sensu stricto could provide cross-protection against Java variants . This suggests functional conservation at the protein level despite genomic divergence.

What experimental design approaches are most effective for studying CbiB's role in vaccine-induced immunity?

To effectively study CbiB's role in vaccine-induced immunity against S. paratyphi B, sophisticated experimental designs are required:

  • Animal model selection and validation:

    • Mouse models have demonstrated utility in evaluating protection against both sensu stricto and Java variants

    • Humanized mouse models may provide more relevant immunological responses

    • Comparative studies across multiple animal models to address translational concerns

  • Immune response characterization:

    • Multi-parameter flow cytometry to profile cellular responses

    • Serological analysis of antibody responses (titer, isotype, avidity)

    • Systems immunology approaches to capture comprehensive immune signatures

  • Challenge study design considerations:

Study ComponentRecommended ApproachVariables to ControlOutcome Measures
Immunization ProtocolPrime-boost strategyDose, route, adjuvant, intervalAb titer, T-cell response
Challenge Strain SelectionMultiple variantsInoculum size, growth phaseBacterial burden, survival
Sample Collection TimelineSequential samplingPre- and post-challenge timepointsKinetics of response
ControlsMock vaccine, irrelevant proteinGenetic background, age, sexBackground response
  • Advanced analytical approaches:

    • Transcriptomic profiling of host responses

    • Correlation of protection analysis to identify immune correlates

    • Machine learning algorithms to predict protective outcomes

Collaboration with specialized bioinformatics platforms can significantly enhance data analysis capabilities, particularly for complex multi-parameter datasets . The successful development of the CVD 2005 vaccine strain demonstrates the feasibility of this approach, showing that engineered S. paratyphi B strains can induce protective immunity against multiple variants .

What are common pitfalls in recombinant CbiB expression and how can they be addressed?

Researchers frequently encounter specific challenges when working with recombinant CbiB protein that require methodological solutions:

  • Low expression yield:

    • Problem: Membrane proteins like CbiB often express poorly in standard systems

    • Solution: Optimize codon usage for expression host; reduce expression temperature to 16-20°C; try specialized strains like C41(DE3) designed for membrane proteins

    • Validation: Compare yields across multiple expression conditions using quantitative Western blot

  • Protein insolubility and inclusion body formation:

    • Problem: CbiB may aggregate in inclusion bodies

    • Solution: Co-express with chaperones (GroEL/ES, DnaK); use fusion partners (MBP, SUMO); optimize lysis buffer detergents

    • Validation: Perform solubility fractionation analysis to quantify improvement

  • Protein instability during purification:

    • Problem: Loss of protein during purification steps

    • Solution: Include stabilizing agents (glycerol, trehalose); maintain detergent above critical micelle concentration; minimize time between purification steps

    • Validation: Monitor protein concentration and activity at each purification stage

  • Loss of functional activity:

    • Problem: Purified protein lacks enzymatic activity

    • Solution: Develop activity assays specific to CbiB function; reconstitute in liposomes to mimic membrane environment; optimize buffer components based on DoE approach

    • Validation: Compare activity of different preparations to identify critical factors for maintaining function

Applying Design of Experiments (DoE) methodology to systematically address these challenges can significantly improve outcomes compared to traditional one-factor-at-a-time troubleshooting approaches .

How can bioinformatic approaches enhance experimental design for S. paratyphi B CbiB research?

Bioinformatic tools and approaches can significantly enhance experimental design for S. paratyphi B CbiB research:

  • Structural prediction and analysis:

    • Homology modeling based on related proteins with known structures

    • Molecular dynamics simulations to predict conformational changes

    • Binding site prediction to identify functional regions for mutagenesis studies

  • Comparative genomics applications:

    • Analysis of conservation across Salmonella serovars to identify functionally critical regions

    • Identification of variant-specific sequence differences between sensu stricto and Java strains

    • Prediction of epitopes for antibody development and immunological studies

  • Experimental design optimization:

    • In silico mutagenesis to prioritize target residues for functional studies

    • Primer design for cloning and site-directed mutagenesis

    • DoE parameter selection guided by machine learning approaches

  • Data integration platforms:

    • Specialized bioinformatics resources like CBiB Bordeaux provide expertise in omics data integration

    • Big data approaches for analyzing complex datasets

    • Custom pipeline development for specific research questions

The application of bioinformatic approaches has already contributed to advances in S. paratyphi B research, including the identification of genomic differences between variants and the development of the CVD 2005 vaccine strain . Continued integration of computational and experimental approaches will further accelerate progress in this field.

What quality control metrics should be employed when working with recombinant CbiB protein?

  • Protein identity and integrity verification:

    • SDS-PAGE analysis to confirm molecular weight and purity (>90% recommended)

    • Western blot with anti-His or CbiB-specific antibodies

    • Mass spectrometry for precise identification and detection of post-translational modifications

    • N-terminal sequencing to confirm proper processing

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to verify secondary structure

    • Thermal shift assays to determine stability

    • Size exclusion chromatography to detect aggregation states

    • Dynamic light scattering for homogeneity analysis

  • Functional validation:

    • Enzyme activity assays specific to CbiB function in cobalamin biosynthesis

    • Binding studies with substrate analogs

    • In vitro reconstitution of enzymatic pathway components

  • Storage stability monitoring:

Storage ConditionRecommended Testing IntervalsKey Parameters to MonitorAcceptance Criteria
-80°C (stock)Every 6 monthsActivity, SDS-PAGE profile>80% initial activity
-20°C (working)MonthlyActivity, aggregation>70% initial activity
4°C (experiment)WeeklyActivity>50% initial activity
  • Batch-to-batch consistency verification:

    • Standardized production protocols based on optimized DoE parameters

    • Reference standard comparison for each new preparation

    • Certificate of analysis documentation for each batch

Appropriate storage in buffer containing 6% trehalose at pH 8.0 and avoiding repeated freeze-thaw cycles are critical for maintaining long-term stability . These quality control measures ensure that experimental results using recombinant CbiB are reliable and reproducible.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.