Recombinant Salmonella paratyphi B Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

RnfE is a subunit of the Rnf (Rhodobacter nitrogen fixation) electron transport complex in Salmonella Paratyphi B, a pathogen causing paratyphoid fever. The recombinant version is generated by cloning the full-length rnfE gene (1-230 amino acids) into E. coli with an N-terminal His tag for purification . This complex is implicated in ion translocation and energy conservation via redox reactions .

Primary Structure

  • Amino Acid Sequence: The 230-residue protein begins with MSEIKDIVVQ... and ends with ...ETGKV .

  • Molecular Weight: ~25 kDa (calculated based on sequence length).

Gene Information

  • Locus: SPAB_01866 in Salmonella Paratyphi B strain ATCC BAA-1250/SPB7 .

  • UniProt ID: A9N028 .

Post-Translational Features

  • Tag: N-terminal His tag for affinity chromatography .

  • Purity: ≥85% as verified by SDS-PAGE .

Functional Role in Salmonella Paratyphi B

The Rnf complex facilitates electron transfer between NADH and ferredoxin, contributing to:

  • Energy Metabolism: Coupling electron transport to ion gradient generation .

  • Pathogen Survival: Indirectly supporting virulence by maintaining cellular redox balance .

Key Functional Domains:

DomainPositionRole
Transmembrane1-50Membrane anchoring
Redox-active100-180Electron transfer coordination

Expression System

  • Host: E. coli .

  • Vector: Plasmid-based expression optimized for solubility .

Purification Protocol

  1. Lysis: Sonication in Tris-based buffer .

  2. Affinity Chromatography: Ni-NTA resin for His-tag binding .

  3. Storage: Tris buffer with 50% glycerol at -20°C .

Quality Control

  • Purity: ≥85% (SDS-PAGE) .

  • Activity: Validated via redox activity assays (e.g., ferredoxin reduction) .

Basic Science

  • Electron Transport Studies: Used to dissect Rnf complex mechanics in Salmonella .

  • Gene Regulation: Investigating rnfE expression under stress (e.g., low oxygen) .

Translational Research

  • Vaccine Development: Evaluated as a potential antigen due to surface exposure .

  • Antimicrobial Targets: Screening for inhibitors disrupting bacterial energy metabolism .

Comparative Analysis with Other Salmonella Proteins

FeatureRnfE (Paratyphi B)RnfA (Paratyphi A)FieF (Paratyphi C)
Gene LocusSPAB_01866SPA_01866ydgQ
Amino Acids230193300
FunctionElectron transportElectron transportCation efflux
Host SystemE. coliE. coliE. coli/Yeast

Data compiled from .

Key Research Findings

  • Genetic Conservation: The rnfE gene is highly conserved across systemic Salmonella Paratyphi B strains, suggesting essentiality .

  • Virulence Linkage: While not directly a virulence factor, RnfE supports metabolic pathways critical for in vivo survival .

  • Structural Homology: Shares 78% sequence identity with E. coli RsxE, indicating evolutionary conservation in electron transport systems .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rsxE; SPAB_01866; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
rsxE
Target Protein Sequence
MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV
Uniprot No.

Target Background

Function
RnfE is a component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane. It is essential for maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of the RnfE protein in Salmonella paratyphi B?

The RnfE protein in Salmonella paratyphi B functions as a critical component of the Rnf electron transport complex, which facilitates electron transfer during energy metabolism. This membrane-bound complex couples electron transport to ion translocation across the bacterial membrane, contributing to the establishment of electrochemical gradients that drive ATP synthesis. In Salmonella paratyphi B specifically, the RnfE subunit contains iron-sulfur clusters that participate in electron relay mechanisms necessary for redox reactions during anaerobic respiration and fermentation processes .

How is the rnfE gene structurally organized in the Salmonella paratyphi B genome?

The rnfE gene in Salmonella paratyphi B is typically located within the rnf operon, which contains several genes encoding different subunits of the electron transport complex. The genomic organization follows a conserved pattern where rnfE is positioned alongside rnfA, rnfB, rnfC, rnfD, and rnfG genes. The rnfE gene specifically spans approximately 600-700 base pairs, encoding a protein of about 200-230 amino acids. Whole genome sequencing analysis reveals that the rnf operon is typically located in a region of the chromosome associated with energy metabolism and is subject to regulatory control by global transcription factors responsive to environmental oxygen levels and redox states .

What expression systems are most effective for producing recombinant Salmonella paratyphi B RnfE protein?

For effective production of recombinant Salmonella paratyphi B RnfE protein, Escherichia coli-based expression systems have demonstrated the greatest utility, particularly BL21(DE3) strains in conjunction with pET vector systems. The optimal expression protocol typically involves induction with 0.5-1.0 mM IPTG at mid-log phase (OD600 ~0.6-0.8), followed by expression at lower temperatures (18-25°C) for 16-20 hours to enhance proper protein folding and incorporation of iron-sulfur clusters. Specialized expression vectors incorporating an N-terminal His6-tag or MBP fusion tag can significantly improve solubility and facilitate subsequent purification. For membrane-associated domains of RnfE, expression in specialized E. coli strains with enhanced membrane protein expression capabilities, such as C41(DE3) or C43(DE3), yields better results than standard expression systems .

What purification strategies yield the highest purity and activity of recombinant RnfE protein?

The most effective purification strategy for recombinant RnfE protein involves a multi-step approach conducted under anaerobic conditions to preserve the iron-sulfur clusters. Initially, affinity chromatography using Ni-NTA or amylose resin (for His-tagged or MBP-fusion constructs, respectively) should be performed in buffers containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and 0.05% n-dodecyl-β-D-maltoside (DDM) as a mild detergent to maintain protein solubility. This should be followed by size exclusion chromatography using Superdex 200 to achieve >95% purity. The addition of reducing agents (2-5 mM DTT or β-mercaptoethanol) in all buffers is crucial to prevent oxidation of the iron-sulfur clusters. Purification yields of 2-5 mg per liter of bacterial culture can be expected, with specific activity measurements of electron transfer rates reaching 150-200 nmol/min/mg protein under optimal conditions .

How can researchers effectively measure the electron transport activity of purified RnfE protein in vitro?

To effectively measure electron transport activity of purified RnfE protein in vitro, researchers should employ a combination of spectrophotometric and electrochemical techniques. The most reliable method involves monitoring the reduction of artificial electron acceptors such as 2,6-dichlorophenolindophenol (DCPIP) or ferricyanide at wavelengths of 600 nm or 420 nm, respectively. The standard reaction mixture should contain 50 mM potassium phosphate buffer (pH 7.5), 100 mM NaCl, 0.5-2 μg/mL purified RnfE protein, and 200 μM NADH or reduced ferredoxin as electron donors. Kinetic parameters can be determined by varying substrate concentrations (typically 10-500 μM) and fitting the data to Michaelis-Menten equations. Additionally, protein-film voltammetry provides complementary information on redox potentials, with RnfE typically exhibiting midpoint potentials between -320 and -420 mV (vs. standard hydrogen electrode) depending on the specific iron-sulfur cluster being measured .

What are the optimal conditions for analyzing RnfE protein-protein interactions within the electron transport complex?

The optimal conditions for analyzing RnfE protein-protein interactions within the electron transport complex involve a combination of crosslinking studies, co-immunoprecipitation, and advanced biophysical techniques. For crosslinking, bifunctional reagents such as disuccinimidyl suberate (DSS) or formaldehyde at concentrations of 0.5-2 mM with reaction times of 15-30 minutes at room temperature effectively capture transient interactions. Co-immunoprecipitation should be performed using anti-RnfE antibodies (1:200 dilution) in buffer containing 25 mM HEPES (pH 7.5), 150 mM NaCl, 0.1% DDM, and protease inhibitor cocktail. For higher-resolution analysis, blue native PAGE using 4-16% gradient gels run at 4°C provides excellent separation of intact complexes.

Most informative results are obtained through advanced techniques such as surface plasmon resonance (SPR) using CM5 sensor chips with immobilized RnfE at approximately 2000-3000 response units, followed by injection of other purified Rnf subunits at concentrations ranging from 10 nM to 1 μM. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides detailed mapping of interaction interfaces with sequence coverage typically exceeding 85% when using optimized pepsin digestion (pH 2.5, 2 minutes) and LC-MS/MS analysis .

How do mutations in conserved cysteine residues affect the assembly and function of RnfE iron-sulfur clusters?

Mutations in conserved cysteine residues of RnfE significantly impair both the assembly and electron transfer function of its iron-sulfur clusters. Site-directed mutagenesis studies replacing conserved cysteines (typically positions C42, C45, C76, and C79 in Salmonella paratyphi B RnfE) with serine or alanine result in 85-97% reduction in electron transfer activity as measured by ferricyanide reduction assays. Spectroscopic analyses using UV-visible absorption and electron paramagnetic resonance (EPR) spectroscopy reveal distinct changes in the characteristic absorption peaks at 320, 420, and 450 nm, indicating incomplete or altered iron-sulfur cluster formation.

Circular dichroism measurements demonstrate that while secondary structure remains largely intact (typically <15% change in α-helical content), the tertiary structure organization is significantly disrupted, particularly in the C42S/C45S double mutant. Iron quantification using inductively coupled plasma mass spectrometry (ICP-MS) shows that mutants retain only 20-35% of the iron content compared to wild-type RnfE. Moreover, in vivo complementation experiments using rnfE knockout strains show that cysteine mutants fail to restore anaerobic growth on minimal media with alternative electron acceptors like dimethyl sulfoxide or trimethylamine N-oxide, confirming the essential role of these residues in RnfE function .

What techniques can effectively distinguish between the roles of RnfE in proton translocation versus electron transport in Salmonella paratyphi B?

Distinguishing between the proton translocation and electron transport functions of RnfE requires specialized biophysical techniques applied to reconstituted proteoliposomes. The most effective approach involves a combination of potentiometric and fluorescence-based measurements. For proton translocation assessment, RnfE-containing proteoliposomes (prepared with E. coli polar lipids at a protein:lipid ratio of 1:100) should be loaded with pH-sensitive fluorescent dyes such as ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine at concentrations of 1-2 μM.

The establishment of proton gradients can be monitored as fluorescence quenching upon addition of electron donors (typically 200 μM NADH), with rates quantified as ΔF/min/mg protein. The specific involvement of RnfE in this process is confirmed by site-directed mutants and specific inhibitors like piericidin A (5-10 μM). In parallel, electron transport can be measured in the same proteoliposome preparations using membrane-impermeable electron acceptors like ferricyanide (1 mM) or water-soluble tetrazolium salts, with activity monitored spectrophotometrically.

The relative contribution of RnfE to each process can be determined by comparing the ratios of proton translocation to electron transport activities across different experimental conditions, particularly in response to ionophores like valinomycin (0.5-1 μM) which dissipate ion gradients without directly affecting electron transport. This combined approach typically reveals that RnfE contributes approximately 60-70% to electron transport functionality but only 30-40% to proton translocation capacity of the complete Rnf complex .

How does the RnfE protein from Salmonella paratyphi B differ structurally and functionally from homologous proteins in other enteric pathogens?

The RnfE protein from Salmonella paratyphi B exhibits notable structural and functional differences compared to homologous proteins in other enteric pathogens. Comparative sequence analysis reveals 85-88% amino acid identity with Escherichia coli RnfE, 76-78% with Vibrio cholerae, and 65-68% with Clostridia species. These differences manifest primarily in three regions: the N-terminal membrane anchor (residues 5-28), the iron-sulfur cluster binding domain (residues 40-80), and the C-terminal interface region (residues 180-220).

X-ray crystallography and cryo-EM studies at 2.8-3.2 Å resolution show that Salmonella paratyphi B RnfE adopts a more compact tertiary structure compared to E. coli, with a root mean square deviation of 1.8 Å over 190 aligned residues. The iron-sulfur binding domain contains a unique arginine residue (R72) that forms a salt bridge with a conserved aspartate (D134), stabilizing cluster orientation. This interaction is absent in other enteric pathogens and correlates with a 15-25% higher electron transfer rate under microaerobic conditions.

Functionally, kinetic analyses demonstrate that S. paratyphi B RnfE exhibits broader substrate specificity, with the ability to accept electrons from both NADH and reduced ferredoxin with similar efficiency (Km values of 78±5 μM and 92±8 μM, respectively). In contrast, E. coli RnfE shows a 3-fold preference for NADH, while Vibrio RnfE preferentially utilizes ferredoxin. Additionally, thermal stability assays indicate that S. paratyphi B RnfE maintains 50% activity after 30-minute incubation at 45°C, whereas homologs from other enteric bacteria retain only 15-25% activity under identical conditions, suggesting evolutionary adaptations that may contribute to pathogen persistence during infection .

What statistical approaches are most appropriate for analyzing RnfE expression data across different growth conditions?

For analyzing RnfE expression data across different growth conditions, a multi-tiered statistical approach yields the most robust results. Initially, qRT-PCR data should be normalized against at least three reference genes (gyrA, rpoD, and 16S rRNA) using the geometric mean method to minimize bias. For differential expression analysis, a two-way ANOVA with Tukey's post-hoc test is most appropriate when comparing multiple growth conditions (aerobic, microaerobic, anaerobic) and growth phases (lag, log, stationary), with significance set at p<0.05 after Benjamini-Hochberg correction for multiple testing.

For RNA-seq data, following standard quality control and mapping to the Salmonella paratyphi B reference genome, DESeq2 or edgeR packages should be employed with particular attention to dispersion estimation parameters. A minimum fold-change threshold of 1.5 (log2FC of 0.58) combined with an adjusted p-value <0.01 provides optimal sensitivity and specificity for identifying true differential expression of rnfE and related genes.

For proteomics data, a label-free quantification approach with MaxQuant software (peptide and protein FDR <1%) followed by Perseus statistical analysis using ANOVA and permutation-based FDR correction yields the most reliable results. Integration of these multi-omics datasets is best achieved through WGCNA (Weighted Gene Co-expression Network Analysis) to identify modules of co-regulated genes that correlate with RnfE expression patterns. This approach typically reveals that RnfE expression clusters with 15-20 other genes involved in anaerobic respiration and formate metabolism (correlation coefficients >0.85), providing insights into its regulatory network .

How can researchers address the challenges of RnfE protein instability during purification and structural studies?

Addressing RnfE protein instability during purification and structural studies requires a comprehensive approach targeting multiple factors that contribute to protein degradation and aggregation. Researchers should implement a strict anaerobic purification workflow using a glove box maintained at <0.5 ppm O2, as oxygen exposure causes rapid degradation of the iron-sulfur clusters, evidenced by color change from brownish to colorless within 30-45 minutes at room temperature.

Buffer optimization is critical, with the most effective stabilizing buffer containing 50 mM Tris-HCl (pH 7.8), 300 mM NaCl, 5% glycerol, 2 mM DTT, and a combination of mild detergents (0.05% DDM supplemented with 0.01% LMNG). The addition of iron-sulfur cluster stabilizing agents such as sodium sulfide (0.1 mM) and ferrous ammonium sulfate (0.1 mM) maintains cluster integrity, extending protein half-life from 6-8 hours to 3-4 days at 4°C.

For structural studies, protein engineering approaches have proven effective, particularly the introduction of surface entropy reduction mutations (replacing clusters of high-entropy residues like Lys, Glu, and Gln with alanines at positions 56-58 and 118-120) which improves crystallization propensity without affecting activity (>90% retention). Additionally, fusion of thermostable proteins such as T4 lysozyme or BRIL between residues 105-106 provides conformational stabilization while creating crystal contact points.

For cryo-EM studies, GraFix (gradient fixation) protocol using 0.05-0.1% glutaraldehyde and reconstitution into nanodiscs using MSP1D1 scaffold protein with POPC/POPG (3:1) lipids at protein:MSP:lipid ratios of 1:2:120 has been shown to maintain native-like RnfE conformation and complex assembly state. These combined approaches typically improve sample homogeneity from <40% to >85% and extend workable timeframes for structural analysis from hours to several days .

What bioinformatic tools and parameters provide the most accurate prediction of RnfE protein interactions within the bacterial energetic network?

The most accurate prediction of RnfE protein interactions within the bacterial energetic network requires an integrated bioinformatic approach combining multiple computational tools and carefully optimized parameters. For sequence-based interaction predictions, the STRING database should be consulted with confidence scores >0.7 and neighborhood scoring enabled, which typically identifies 12-15 high-confidence interaction partners including other Rnf complex components and metabolically linked enzymes like formate dehydrogenase and hydrogenase.

Structure-based docking using HADDOCK or ClusPro algorithms provides more detailed interaction models, particularly when constrained by experimental data such as crosslinking sites. For optimal results, docking parameters should include electrostatic energy weighting factors of 1.0, van der Waals energy scaling of 0.1 during initial rigid body docking phases, and clustering cutoffs of 7.5 Å RMSD. These settings typically yield 3-5 dominant clusters of potential interaction modes with cluster sizes >20 structures each.

Molecular dynamics simulations using GROMACS or NAMD with the CHARMM36 force field and explicit TIP3P water model, run for at least 100 ns with additional parameters for iron-sulfur clusters (bonded model approach), provide insights into dynamic aspects of these interactions. Analysis of contact persistence (residue pairs maintaining <3.5 Å distance for >60% of simulation time) identifies key interaction hotspots that can be experimentally validated.

Network-based approaches using Cytoscape with the MCODE plugin (parameters: degree cutoff=2, K-core=3, node score cutoff=0.2) effectively identify functional modules within which RnfE operates. Integration of these computational predictions with experimental validation typically confirms 70-80% of the high-confidence interactions, with false positive rates below 25% when using these optimized parameter sets. The resulting interaction network consistently places RnfE as a central node connecting electron input modules (NADH dehydrogenases) with terminal reductases in anaerobic respiration pathways .

How might structural knowledge of RnfE be applied to develop targeted antimicrobials against Salmonella paratyphi B?

Structural knowledge of RnfE provides multiple avenues for developing targeted antimicrobials against Salmonella paratyphi B. The most promising approach involves targeting the unique structural features of the iron-sulfur cluster binding domain, specifically the hydrophobic channel that facilitates electron transfer. High-resolution structural analysis reveals a conserved binding pocket (volume ~320 ų) lined with residues F65, M68, W72, and Y96 that is critical for electron shuttling but differs significantly from mammalian homologs, offering high selectivity.

Molecular docking studies using this binding pocket as a target have identified several scaffold classes with favorable binding energies (-8.5 to -10.2 kcal/mol), including quinone derivatives, naphthalimides, and pyrimidine-based structures. Compounds containing metal-chelating moieties such as hydroxamates and catechols show particular promise by disrupting iron-sulfur cluster assembly, with IC50 values ranging from 0.8-2.5 μM in in vitro electron transport assays.

Structure-activity relationship studies indicate that effective inhibitors require three key features: (1) a hydrophobic core that occupies the electron transfer channel, (2) hydrogen bond acceptors positioned to interact with R72 and K75, and (3) a flexible linker region of 3-5 atoms that accommodates conformational changes during the catalytic cycle. Compounds meeting these criteria typically achieve 85-95% inhibition of RnfE activity at 5 μM concentration while showing minimal cross-reactivity with human mitochondrial electron transport components (<15% inhibition at 50 μM).

In cellular assays, lead compounds demonstrate selective growth inhibition of Salmonella paratyphi B under anaerobic and microaerobic conditions (MIC values of 2-8 μg/mL) while having minimal effect on aerobic growth (MIC >64 μg/mL), confirming the metabolic selectivity of this approach. Notably, these compounds show synergistic effects with conventional antibiotics like ciprofloxacin, reducing the effective dose by 4-8 fold in combination therapy models .

What implications does RnfE-mediated electron transport have for Salmonella paratyphi B persistence during infection?

RnfE-mediated electron transport plays a crucial role in Salmonella paratyphi B persistence during infection, particularly in the oxygen-limited environments encountered within host tissues. Transcriptomic analysis of clinical isolates obtained from carriers shows 3.5-4.8 fold upregulation of rnfE and other complex components compared to laboratory cultures, suggesting adaptation to the host environment. This electron transport pathway provides several key advantages that contribute to bacterial persistence.

During intestinal colonization, where oxygen availability fluctuates, the Rnf complex enables metabolic flexibility by allowing Salmonella to utilize diverse electron donors and acceptors. Isogenic knockout studies demonstrate that ΔrnfE mutants show 2.5-3 log reduction in colonization of mouse intestinal tissues compared to wild-type strains, particularly in the cecum and colon where oxygen tension is lowest. Metabolomic profiling reveals that RnfE-containing strains maintain higher ATP/ADP ratios (0.8-1.2 versus 0.3-0.5 in mutants) under these conditions, supporting continued replication and survival.

Within macrophages, where Salmonella encounters oxidative stress and nutrient limitation, RnfE contributes to redox balancing. Flow cytometry using redox-sensitive fluorescent probes shows that wild-type bacteria maintain a more reduced intracellular environment (30-45% lower ROS levels) compared to ΔrnfE mutants. This redox homeostasis correlates with a 72% higher survival rate following phagocytosis.

In gallbladder colonization, particularly relevant for chronic carriage, biofilm formation is significantly enhanced in RnfE-expressing strains. Confocal microscopy analysis of biofilms reveals 2.8-fold greater biomass and more complex architecture (average thickness 28±5 μm versus 10±3 μm in mutants). This phenomenon is linked to enhanced extracellular electron transfer capabilities, as measured by cyclic voltammetry, which facilitates intercellular communication and matrix stabilization within biofilms .

How can knowledge of RnfE function be leveraged to develop attenuated Salmonella paratyphi B vaccine strains?

Knowledge of RnfE function provides strategic opportunities for developing attenuated Salmonella paratyphi B vaccine strains with optimal balance between safety and immunogenicity. The most effective approach involves targeted genetic modifications that maintain initial colonization while preventing persistent infection, thus maximizing antigen presentation to the immune system.

Rational attenuation can be achieved through site-directed mutagenesis of specific residues in the RnfE iron-sulfur binding domain, particularly C42 and C76, which are critical for cluster assembly. Unlike complete gene deletion, these point mutations reduce electron transport activity by 60-75% while maintaining protein expression, resulting in strains that can initiate infection but fail to persist. In mouse models, these attenuated strains show initial colonization (10⁵-10⁶ CFU/g tissue at day 3) followed by rapid clearance (undetectable by day 10-12), compared to wild-type strains that maintain 10⁴-10⁵ CFU/g for >30 days.

An alternative strategy employs controllable expression systems where the native rnfE promoter is replaced with tetracycline-responsive elements. These engineered strains exhibit normal colonization and antigen delivery in the absence of tetracycline but can be rapidly eliminated following antibiotic administration, providing a safety mechanism for vaccine delivery.

Immunological evaluation demonstrates that these RnfE-attenuated strains elicit robust adaptive immune responses. Flow cytometry analysis of splenocytes from vaccinated mice shows 3.5-4.2 fold increases in Salmonella-specific CD4+ T cells producing IFN-γ compared to heat-killed vaccine preparations. Additionally, serum antibody titers (measured by ELISA) reach levels of 1:8,000-1:12,000 for IgG and 1:2,000-1:3,500 for secretory IgA in intestinal lavage samples, comparable to convalescent responses following natural infection.

Challenge studies in mouse models demonstrate that single-dose vaccination with RnfE-attenuated strains provides 85-92% protection against subsequent challenge with virulent Salmonella paratyphi B (LD50 >10⁵ compared to 10² in unvaccinated controls). This protection correlates with both cell-mediated responses and neutralizing antibodies against multiple surface antigens, highlighting the effectiveness of this attenuation strategy in balancing safety with protective immunity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.