Recombinant Salmonella paratyphi B Fumarate reductase subunit D (frdD)

What is the structural composition of Salmonella paratyphi B Fumarate reductase subunit D?

Salmonella paratyphi B Fumarate reductase subunit D (frdD) is a 13 kDa hydrophobic protein that functions as part of the fumarate reductase complex. The protein consists of 119 amino acids with the sequence: MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVIVLLVGIMLPLGLFPGDALSFERV LTFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTAIGVITL . The protein is characterized by its hydrophobic nature, which facilitates its integration into the membrane. As a subunit of the fumarate reductase complex, frdD anchors the catalytic components to the membrane, enabling electron transport during anaerobic respiration in Salmonella species.

What expression systems are most effective for producing recombinant frdD protein?

For optimal expression of recombinant Salmonella paratyphi B frdD, E. coli-based expression systems are commonly employed with specific modifications to accommodate the hydrophobic nature of the protein. The most effective systems typically utilize:

• pET expression systems with T7 promoters under IPTG control, allowing for high-yield production

• Codon-optimized sequences to enhance translation efficiency in the host organism

• Fusion tags such as His6, GST, or MBP to facilitate purification and potentially increase solubility

• Specialized E. coli strains engineered for membrane protein expression (e.g., C41(DE3) or C43(DE3))

For hydrophobic proteins like frdD, expression conditions typically require lower induction temperatures (16-25°C) and moderate inducer concentrations to prevent formation of inclusion bodies and maintain proper membrane integration.

What are the optimal storage conditions for recombinant frdD protein?

Recombinant frdD protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended preservation . To maintain protein integrity, consider these best practices:

• Divide the protein into small working aliquots (20-50 μL) to avoid repeated freeze-thaw cycles

• Store working aliquots at 4°C for up to one week to minimize degradation

• Avoid repeated freezing and thawing, as this can significantly reduce protein activity

• Include protease inhibitors in storage buffers if degradation is observed

• Monitor protein stability periodically through activity assays or gel electrophoresis

For long-term archiving, lyophilization may be considered but should be validated to ensure the protein retains functionality upon reconstitution.

How can I verify the identity and purity of recombinant frdD protein?

Verification of recombinant frdD identity and purity should employ a multi-method approach:

• SDS-PAGE analysis: Should show a band at approximately 13 kDa, corresponding to the predicted molecular weight of frdD

• Western blotting: Using anti-frdD antibodies or anti-tag antibodies if a fusion protein construct is used

• Mass spectrometry: For precise molecular weight determination and peptide mapping

• N-terminal sequencing: To confirm the correct amino acid sequence

For purity assessment, densitometry analysis of SDS-PAGE gels should indicate >90% purity for most research applications. Size exclusion chromatography can provide additional purity information and detect potential aggregation. Given the hydrophobic nature of frdD, specialized detergent-based electrophoresis methods may be required for optimal resolution.

What are the key considerations for designing experiments involving frdD mutation analysis?

When designing experiments for frdD mutation analysis in Salmonella paratyphi B, researchers should consider:

• Mutation strategy selection:

  • Site-directed mutagenesis for targeted amino acid changes

  • Deletion mutagenesis to assess domain functionality

  • Random mutagenesis for functional screens

• Phenotypic assessment plan:

  • Growth curves under aerobic vs. anaerobic conditions

  • Fumarate reductase activity assays

  • Membrane integration analysis

• Controls:

  • Wild-type strain

  • Empty vector controls

  • Complementation controls to verify phenotype restoration

• Experimental validation:

  • Multiple independent mutants to confirm phenotypes

  • Sequence verification of all constructs

  • Protein expression confirmation

For robust experimental design, use the Framework for Reliable Experimental Design (FRED) principles, ensuring proper planning, implementation, and analysis to establish reliable findings .

How can I assess the functional activity of recombinant frdD in vitro?

Assessing functional activity of recombinant frdD requires specialized methods due to its role as a membrane anchor subunit:

• Reconstitution assays:

  • Incorporate purified frdD into liposomes or nanodiscs

  • Combine with other fumarate reductase subunits (frdA, frdB, frdC)

  • Measure complex formation using crosslinking or co-immunoprecipitation

• Membrane insertion analysis:

  • Protease accessibility assays to determine topology

  • Fluorescence resonance energy transfer (FRET) with labeled components

  • Differential scanning calorimetry to assess membrane stability

• Electron transport activity:

  • Measure electron transfer using artificial electron donors/acceptors

  • Monitor fumarate reduction spectrophotometrically at 300 nm

  • Assess proton translocation using pH-sensitive dyes

A comprehensive analysis should combine multiple approaches to distinguish between protein expression, membrane insertion, complex formation, and enzymatic activity contributions.

What genetic engineering approaches are most effective for frdD modification in Salmonella paratyphi B?

For effective genetic modification of frdD in Salmonella paratyphi B, consider these validated methodologies:

• Homologous recombination:

  • Lambda Red recombinase system for precise chromosomal modifications

  • Integration of modified frdD variants at the native locus

  • Counter-selection markers (e.g., sacB) for marker-free modifications

• CRISPR-Cas9 gene editing:

  • Design specific gRNAs targeting the frdD locus

  • Introduce donor templates with desired modifications

  • Screen transformants using PCR and sequencing

• Suicide vector integration:

  • Vectors like pYG4 that cannot replicate in Salmonella

  • Selection for chromosomal integration events

  • Counter-selection for excision of vector backbone

Similar approaches have been successfully used for other Salmonella genes such as htrA, phoP/phoQ, and sptP in Salmonella Paratyphi A , and can be adapted for frdD modification in S. Paratyphi B.

How does frdD contribute to the pathogenesis and virulence of Salmonella paratyphi B?

The contribution of frdD to Salmonella paratyphi B pathogenesis is multifaceted and involves several metabolic adaptations:

• Anaerobic respiration: As part of the fumarate reductase complex, frdD enables S. paratyphi B to use fumarate as a terminal electron acceptor during oxygen limitation in host tissues, particularly within macrophages and the intestinal lumen.

• Metabolic adaptation: The fumarate reductase complex contributes to pathogen fitness during infection by facilitating:

  • Energy generation under anaerobic conditions

  • Utilization of alternative carbon sources

  • Adaptation to nutrient-limited environments within host cells

• Intracellular survival: There is evidence that fumarate metabolism may contribute to resistance against host defense mechanisms, similar to what has been observed with other metabolic genes in Salmonella.

While not directly analogous to virulence factors like those in the Type III secretion system (e.g., SptP) , frdD's role in energy metabolism makes it an important contributor to S. paratyphi B survival during infection. This relationship between metabolism and virulence represents an emerging area for therapeutic intervention.

What are the challenges in developing antibodies against recombinant frdD for research applications?

Developing effective antibodies against recombinant frdD presents several unique challenges:

• Hydrophobicity: The highly hydrophobic nature of frdD (as evidenced by its amino acid sequence) can limit epitope accessibility and require specialized immunization strategies.

• Conformational considerations: The native membrane-embedded conformation of frdD differs significantly from solubilized recombinant forms, potentially yielding antibodies that recognize denatured but not native protein.

• Cross-reactivity concerns: High sequence conservation among fumarate reductase D subunits across bacterial species can result in antibodies with limited specificity for S. paratyphi B.

To address these challenges, researchers should consider:

• Using synthetic peptides from hydrophilic regions as immunogens

• Employing recombinant frdD fragments fused to carrier proteins

• Developing monoclonal antibodies with stringent screening for specificity

• Validating antibodies using knockout strains and Western blots with multiple controls

How can recombinant frdD be utilized in vaccine development strategies against Salmonella paratyphi B?

While traditional vaccine approaches for Salmonella have focused on O-polysaccharides, outer membrane proteins, and secretion system components , recombinant frdD offers potential alternative pathways for vaccine development:

• Subunit vaccine components:

  • Hydrophilic epitopes of frdD could be incorporated into multi-epitope vaccines

  • Fusion protein constructs combining frdD peptides with immunogenic carriers

• Live attenuated vaccine platforms:

  • Engineered S. paratyphi B strains with modified frdD expression

  • Metabolic attenuation through frdD mutation combined with other attenuating mutations

• Novel delivery approaches:

  • Outer membrane vesicles (OMVs) containing frdD

  • Nanoparticle formulations displaying frdD epitopes

A promising strategy involves combining frdD-targeted approaches with established vaccine technologies. For example, the S. Paratyphi A vaccine approach using chromosomal integration of the viaB locus could be adapted to include modifications of frdD in S. paratyphi B, potentially creating a metabolically attenuated strain with enhanced immunogenicity.

What comparative analysis approaches should be used when studying fumarate reductase subunit D across different Salmonella serovars?

When conducting comparative studies of fumarate reductase subunit D across Salmonella serovars, implement these systematic approaches:

• Sequence analysis pipeline:

  • Multiple sequence alignment of frdD homologs

  • Phylogenetic analysis to establish evolutionary relationships

  • Identification of conserved versus variable regions

  • Prediction of functional domains and transmembrane segments

• Structural comparison:

  • Homology modeling based on available crystal structures

  • Molecular dynamics simulations in membrane environments

  • Identification of serovar-specific structural features

• Functional characterization:

  • Cross-complementation experiments between serovars

  • Enzyme kinetics comparison under standardized conditions

  • Membrane integration efficiency assessment

• Expression pattern analysis:

  • Transcriptomic profiling across growth conditions

  • Comparison of regulation mechanisms between serovars

  • Protein abundance quantification using targeted proteomics

This comparative approach can reveal important insights into how metabolic adaptations contribute to the distinct host preferences and disease manifestations observed between Salmonella serovars such as S. Typhi, S. Paratyphi A, and S. Paratyphi B .

What strategies can overcome low expression yields of recombinant frdD?

Low expression yields of recombinant frdD are common due to its hydrophobic nature. Implement these evidence-based strategies to improve production:

• Expression system optimization:

  • Test alternative E. coli strains specialized for membrane proteins (C41/C43)

  • Evaluate different promoter systems (trc, ara, T5) for optimal expression level

  • Consider cell-free expression systems for difficult constructs

• Growth condition modifications:

  • Reduce induction temperature to 16-20°C

  • Decrease inducer concentration (0.1-0.5 mM IPTG)

  • Supplement media with glycerol (0.5-2%) to support membrane formation

  • Add specific lipids that promote membrane protein integration

• Construct engineering:

  • Add solubility-enhancing fusion partners (MBP, NusA, Trx)

  • Optimize codon usage for expression host

  • Consider expression of individual transmembrane segments

• Purification approach:

  • Use specialized detergents (DDM, LDAO, or FC-12)

  • Implement on-column detergent exchange protocols

  • Add stabilizing agents during purification

Systematic testing of these variables using Design of Experiments (DoE) methodology can efficiently identify optimal conditions for your specific construct.

How should researchers address potential data inconsistencies in frdD functional studies?

When encountering data inconsistencies in frdD functional studies, apply this systematic troubleshooting framework:

• Sample preparation validation:

  • Verify protein integrity with fresh aliquots

  • Confirm protein concentration using multiple methods

  • Assess aggregation state using size exclusion chromatography

• Assay condition standardization:

  • Control temperature precisely (±0.5°C)

  • Prepare fresh buffers and reagents

  • Validate pH stability throughout experiments

  • Minimize variability in detergent concentrations

• Instrumentation verification:

  • Calibrate spectrophotometers/fluorimeters regularly

  • Perform positive and negative control reactions

  • Include internal standards when possible

• Data analysis refinement:

  • Apply appropriate statistical tests

  • Identify and address outliers systematically

  • Implement blinding in analysis when feasible

• Biological variability assessment:

  • Test multiple protein preparations

  • Consider batch effects in expression systems

  • Account for genetic background differences

Following the Framework for Reliable Experimental Design (FRED) principles can help establish more reliable findings by ensuring proper planning, implementation, and analysis of experiments.

What are the most effective methods for analyzing frdD membrane integration?

Analyzing membrane integration of frdD requires specialized techniques due to its hydrophobic nature. The most effective methods include:

• Biochemical fractionation approaches:

  • Differential centrifugation to isolate membrane fractions

  • Sucrose gradient ultracentrifugation for membrane subfractionation

  • Carbonate extraction (pH 11.5) to distinguish peripheral from integral proteins

• Protease accessibility assays:

  • Controlled proteolysis of intact bacterial cells

  • Proteolysis of inside-out versus right-side-out membrane vesicles

  • Mass spectrometry analysis of protected fragments

• Fluorescence-based techniques:

  • GFP fusion analysis for localization studies

  • Site-specific labeling with environment-sensitive fluorophores

  • Fluorescence quenching assays to determine topological organization

• Electron microscopy approaches:

  • Immunogold labeling of thin sections

  • Freeze-fracture electron microscopy

  • Cryo-electron microscopy of membrane preparations

For quantitative assessment, combine multiple approaches and include appropriate controls (cytoplasmic and known membrane proteins) processed in parallel to validate fractionation quality.

How can structural studies of frdD contribute to understanding energy metabolism in Salmonella?

Structural investigations of frdD can provide critical insights into Salmonella energy metabolism through:

• Membrane complex organization:

  • High-resolution structures of complete fumarate reductase complexes

  • Analysis of subunit interactions between frdD and catalytic components

  • Identification of critical residues for complex stability

• Electron transport mechanisms:

  • Elucidation of proton transfer pathways

  • Mapping of quinone binding sites and interactions

  • Structural changes associated with different redox states

• Membrane adaption insights:

  • Lipid-protein interactions that modulate activity

  • Structural adaptations to different membrane environments

  • Conformational changes in response to environmental conditions

Future structural studies should employ innovative approaches like:

• Cryo-electron microscopy in native-like lipid environments

• Hydrogen-deuterium exchange mass spectrometry

• Molecular dynamics simulations in model membranes

These investigations could reveal how metabolic adaptations enable Salmonella to thrive in diverse host environments, potentially identifying new targets for antimicrobial development.

What role might frdD play in antimicrobial resistance mechanisms?

The potential role of frdD in antimicrobial resistance involves several interconnected mechanisms:

• Metabolic adaptation pathways:

  • Fumarate reductase activity can support bacterial survival under antibiotic stress

  • Alternative electron transport chains may maintain energy production when primary pathways are inhibited

  • Metabolic flexibility could enable persistence during antibiotic therapy

• Membrane composition effects:

  • frdD-containing complexes may influence membrane properties and permeability

  • Changes in membrane organization could affect antibiotic penetration

  • Altered proton gradients might impact the efficacy of antibiotics dependent on membrane potential

• Stress response coordination:

  • Metabolic shifts involving fumarate reductase may signal stress responses

  • Cross-talk between energy metabolism and resistance mechanisms

  • Potential role in bacterial persistence and tolerance

Future research should investigate how frdD expression patterns change in response to antibiotics and whether specific mutations in frdD correlate with increased resistance profiles. Combination therapies targeting both conventional mechanisms and metabolic adaptations might overcome resistance challenges.

How can systems biology approaches incorporate frdD function into metabolic models of Salmonella?

Integrating frdD function into systems biology models of Salmonella metabolism requires multi-level approaches:

The resulting integrated models can predict how metabolic adaptations involving frdD contribute to Salmonella survival and pathogenesis, potentially identifying new therapeutic targets that disrupt essential metabolic functions.

What evolutionary insights can be drawn from comparing frdD sequences across bacterial species?

Comparative analysis of frdD sequences across bacterial species reveals important evolutionary patterns:

• Conservation and divergence patterns:

  • Core transmembrane domains show high conservation

  • Species-specific variations occur primarily in loop regions

  • Sequence conservation correlates with functional constraints

• Phylogenetic relationships:

  • frdD phylogeny largely mirrors species phylogeny, suggesting vertical inheritance

  • Occasional horizontal gene transfer events in specific lineages

  • Co-evolution with other fumarate reductase subunits

• Selective pressures:

  • Evidence of purifying selection on functional domains

  • Adaptive evolution in regions interfacing with other subunits

  • Host-specific adaptations in pathogenic species

• Functional adaptation signatures:

  • Convergent evolution in unrelated anaerobic bacteria

  • Niche-specific amino acid substitutions

  • Correlation between sequence variations and ecological habitats

These evolutionary insights can inform the development of targeted intervention strategies that exploit species-specific features while minimizing cross-reactivity with host or beneficial microbiota.

How does frdD function compare between systemic and enteric pathovars of Salmonella?

The functional comparison of frdD between systemic and enteric pathovars of Salmonella reveals distinct adaptation patterns:

• Expression regulation differences:

  • Systemic pathovars show differential regulation of frdD in response to host signals

  • Enteric variants maintain more constitutive expression patterns

  • Oxygen-dependent regulation varies between pathovars

• Activity profile variations:

  • Systemic pathovars may exhibit optimized enzyme kinetics for intracellular environments

  • Enteric variants show adaptation to intestinal conditions

  • Temperature-dependent activity profiles reflect host adaptation

• Structural adaptations:

  • Subtle sequence variations affect interaction with other complex components

  • Membrane integration efficiency may differ between pathovars

  • Post-translational modifications could vary based on lifestyle

This functional divergence aligns with broader patterns observed in Salmonella pathovars, where systemic and enteric strains show distinct virulence gene patterns . Understanding these differences can provide insights into the evolutionary trajectories that shape pathogen specialization and host adaptation.