Recombinant Salmonella paratyphi B Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; SPAB_04251; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
mscL
Target Protein Sequence
MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT LREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEE VLLGEIRDLLKEQNNRS
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant mscL protein?

Recombinant mscL protein stability is optimized by storing at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid protein degradation. The protein typically comes in lyophilized powder form and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (optimally 50%) and store in aliquots at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided. For working aliquots, storage at 4°C for up to one week is acceptable .

How can researchers verify the purity and identity of recombinant mscL?

Verification of recombinant mscL can be performed through multiple complementary approaches:

  • SDS-PAGE analysis: A purity greater than 90% is typically confirmed by SDS-PAGE .

  • Western blot: Using anti-His antibodies to detect the N-terminal His-tag.

  • Mass spectrometry: For precise molecular weight determination and sequence verification.

  • Functional assays: Patch-clamp recordings can validate the mechanosensitive properties of the channel .

What expression systems are most effective for producing functional recombinant mscL?

The E. coli expression system has been demonstrated to be effective for producing functional recombinant Salmonella paratyphi B mscL protein . When designing expression systems, researchers should consider:

  • Vector selection: Vectors with strong, inducible promoters (e.g., T7) are preferred.

  • Affinity tags: N-terminal His-tags facilitate purification without significantly affecting protein function .

  • Host strain selection: BL21(DE3) or similar strains optimized for membrane protein expression are recommended.

  • Growth conditions: Lower temperatures (16-25°C) after induction may improve proper folding.

  • Induction parameters: IPTG concentration and induction time should be optimized.

How can researchers optimize the purification of recombinant mscL?

For optimal purification of recombinant His-tagged mscL protein, consider this methodological approach:

  • Cell lysis: Use gentle detergent-based methods to solubilize the membrane-bound protein.

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin.

  • Intermediate purification: Size exclusion chromatography to remove aggregates.

  • Detergent exchange: If necessary for downstream applications.

  • Quality control: Assess purity by SDS-PAGE (>90% purity is standard) .

  • Protein concentration: Use centrifugal concentrators with appropriate molecular weight cut-offs.

  • Buffer optimization: The final product is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

How can recombinant mscL be used for mechano-sensitization of neuronal networks?

Recombinant bacterial mechanosensitive channels like mscL represent a promising tool for developing remote stimulation techniques for neuronal tissues . The process involves:

  • Heterologous expression: Engineering the mscL gene for expression in mammalian neuronal cells.

  • Validation: Functional expression can be confirmed through patch-clamp recordings upon application of calibrated suction pressures .

  • Network characterization: Assessment of cell survival, synaptic puncta formation, and spontaneous network activity after mscL expression .

  • Mechanical stimulation: Development of precise methods to deliver mechanical stimuli to activate the channels in specific neuronal populations.

This approach offers several advantages over traditional neuromodulation techniques:

  • Non-invasive stimulation capability

  • Cell-type specificity through targeted gene delivery

  • Potential for remote activation of defined neuronal circuits

What genomic modifications of mscL can enhance its research applications?

The mscL protein can be genetically engineered to create variants with different properties:

  • Sensitivity modifications: Mutations that alter the tension threshold for channel opening.

  • Ion selectivity alterations: Changes to the pore-lining residues can modify ion selectivity.

  • Optical control integration: Engineering light-sensitive domains for optogenetic control.

  • Voltage sensitivity: Introduction of charged residues to create voltage-dependent variants.

  • Reporter fusion proteins: Addition of fluorescent proteins for visualization and localization studies.

These modifications expand the versatility of mscL as a research tool for mechanobiology, neuroscience, and synthetic biology applications .

What electrophysiological methods are recommended for characterizing mscL function?

Rigorous functional characterization of recombinant mscL channels requires specialized electrophysiological techniques:

  • Patch-clamp recording: The gold standard for direct measurement of mechanosensitive channel activity.

    • Cell-attached configuration: For single-channel recordings with applied suction.

    • Whole-cell configuration: For measuring population responses.

    • Excised patch configuration: For controlled manipulation of membrane tension.

  • Pressure-clamp system: Allows precise control of pressure/suction applied to the patch pipette.

  • Data analysis parameters:

    ParameterMeasurementTypical Values
    ConductanceSingle-channel current/voltage2-3 nS
    Activation thresholdNegative pressure at opening~70 mmHg
    Open probabilityFunction of membrane tensionSigmoidal curve
    KineticsOpen/closed dwell timesms range
  • Validation controls: Comparison with known mechanosensitive channel blockers or mutations .

How can researchers investigate mscL structure-function relationships?

To elucidate structure-function relationships of mscL, researchers typically employ:

  • Site-directed mutagenesis: Systematic mutation of key residues followed by functional assays.

  • Chimeric proteins: Swapping domains between different mechanosensitive channels.

  • Truncation analysis: Determining the role of specific protein segments.

  • Cross-linking studies: Identifying interacting residues during channel gating.

  • Computational molecular dynamics: Simulating channel behavior under membrane tension.

Results from these approaches can be integrated to develop comprehensive models of channel gating mechanisms and identify critical residues for tension sensing and pore formation.

How should researchers design experiments to study mscL in heterologous expression systems?

When investigating mscL in heterologous systems such as mammalian cells or neuronal networks, consider this methodological framework:

  • Vector design considerations:

    • Appropriate promoter for target cell type

    • Codon optimization for host expression system

    • Inclusion of trafficking signals if necessary

    • Reporter genes for expression verification

  • Transfection/transduction optimization:

    • Method selection based on cell type (lipofection, electroporation, viral vectors)

    • Expression timing assessment (typically 24-72 hours post-transfection)

    • Transfection efficiency quantification

  • Functional validation protocol:

    • Patch-clamp recordings with calibrated suction pressures

    • Cell viability assessments pre/post channel activation

    • Network activity recordings (for neuronal systems)

  • Control experiments:

    • Non-functional mutant channels

    • Non-transfected cells

    • Selective channel blockers if available

This experimental design enables robust investigation of mscL function in diverse cellular contexts.

What approaches are most effective for studying the role of mscL in bacterial physiology?

To investigate native mscL function in Salmonella paratyphi B:

  • Gene knockout methodology:

    • CRISPR-Cas9 or homologous recombination techniques

    • Phenotypic characterization under osmotic stress conditions

    • Complementation studies with wild-type or mutant mscL

  • Physiological stress responses:

    • Survival rates during hypoosmotic shock

    • Growth curves under varying osmotic conditions

    • Cell morphology analysis pre/post osmotic challenge

  • In vivo channel activity:

    • Fluorescent dye efflux assays during osmotic downshock

    • Real-time monitoring of cellular solute content

    • Membrane tension measurements using molecular probes

  • Pathogenesis studies:

    • Virulence assessment in cellular and animal models

    • Host-pathogen interaction dynamics

    • Survival within host environments with varying osmolarity

These approaches provide comprehensive insights into the physiological importance of mscL in Salmonella paratyphi B biology and potentially its role in pathogenesis .

How might mscL function relate to Salmonella paratyphi B virulence and infection?

The relationship between mscL function and Salmonella paratyphi B pathogenesis remains an area requiring further research, but several hypotheses can be explored:

  • Osmotic adaptation during infection:

    • mscL may help bacteria respond to osmotic challenges in different host compartments

    • Potential role during transition from gastrointestinal environment to systemic infection

  • Host-pathogen interactions:

    • Expression patterns of mscL during different infection stages

    • Potential regulation by host-derived signals or environmental cues

  • Chronic carriage mechanisms:

    • Possible involvement in adaptation to gallbladder environment (relevant to chronic carriers)

    • Response to bile salts and osmotic fluctuations

  • Antibiotic resistance considerations:

    • mscL-mediated responses to membrane-targeting antimicrobials

    • Potential role in bacterial persistence under antibiotic stress

Understanding these connections could provide insights into paratyphoid B fever pathogenesis, which remains a significant public health concern in areas with poor hygiene conditions .

What emerging technologies might advance mscL research?

Several cutting-edge approaches show promise for advancing our understanding of mscL structure, function, and applications:

  • Cryo-electron microscopy: For high-resolution structural determination of mscL in different conformational states.

  • Advanced optogenetic tools: Development of light-activated mscL variants for precise spatiotemporal control.

  • Nanodiscs and synthetic bilayers: For studying channel function in defined lipid environments.

  • Single-molecule force spectroscopy: Direct measurement of forces involved in channel gating.

  • Computational approaches:

    • Molecular dynamics simulations of channel-membrane interactions

    • Machine learning for predicting channel properties and modifications

  • High-throughput screening platforms: For identifying modulators of channel activity.

  • In vivo imaging techniques: For visualizing channel dynamics in living cells and organisms.

These technologies will likely facilitate deeper understanding of mechanosensation mechanisms and expand potential applications of mscL in basic research and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.