Recombinant Salmonella paratyphi B NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
nuoA; SPAB_00649; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled with proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salmonella paratyphi B and how does it differ from other Salmonella serotypes?

Salmonella paratyphi B is a serotype of Salmonella enterica that causes paratyphoid fever, a systemic enteric illness. It differs from other Salmonella serotypes in several important ways:

Salmonella paratyphi B belongs to a complex that has been a source of confusion for microbiologists due to its two distinct biotypes:

  • Salmonella Paratyphi B sensu stricto (d-tartrate negative): Causes paratyphoid fever, an invasive systemic illness

  • Salmonella Paratyphi B Java (d-tartrate positive): Typically causes gastroenteritis similar to other non-typhoidal Salmonella infections

Whole-genome sequencing has revealed that the S. Paratyphi B complex comprises multiple distinct lineages, with the invasive S. Paratyphi B sensu stricto isolates grouped into a single lineage (phylogroup 1 or PG1), while S. Java strains comprise diverse lineages .

Unlike S. Typhi and S. Paratyphi A which have undergone genomic decay resulting in the loss of 12 specific SPI2 effectors, S. Paratyphi B maintains a different genomic profile that influences its pathogenesis and host interactions .

What is NADH-quinone oxidoreductase and what role does NuoA play in this complex?

NADH-quinone oxidoreductase (Complex I) is a large multi-subunit enzyme complex that forms the first entry point for electrons in the respiratory chain. This complex is essential for bacterial energy metabolism and consists of multiple subunits including NuoA, NuoB, and NuoK that work together in electron transfer.

Key characteristics of NuoA in Salmonella paratyphi B include:

  • It is a membrane-associated protein that contributes to the structure and function of Complex I

  • The protein has a UniProt ID of A9N4C4 and consists of 147 amino acids in S. paratyphi B

  • NuoA is involved in coupling electron transfer from NADH to quinones with proton translocation across the membrane, contributing to the generation of the proton motive force

The recombinant form of NuoA represents an isolated protein subunit that can be used for various research applications, including structural studies, functional assays, and antibody production.

What are the recommended storage and handling conditions for recombinant NuoA protein?

For optimal stability and activity of recombinant Salmonella paratyphi B NuoA protein:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, store working aliquots at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 30-50% and store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • Use Tris-based buffer with 50% glycerol (pH 8.0) for optimal stability

When reconstituting lyophilized protein, it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL before use in experiments. Proper aliquoting after initial reconstitution can minimize freeze-thaw cycles and maintain protein stability.

How can NuoA contribute to vaccine development against Salmonella paratyphi B infections?

While no specific NuoA-based vaccines are described in the literature, the protein could potentially contribute to vaccine strategies in several ways:

As a vaccine component:

  • NuoA's essential metabolic role makes it a conserved antigen that could potentially be incorporated into subunit vaccines

  • Being a membrane-associated protein, certain exposed epitopes might be accessible to antibodies, potentially generating protective immune responses

As a model for comparative studies:
Recent research describes a live attenuated Salmonella Paratyphi B vaccine strain (CVD 2005) containing mutations in guaBA and clpX genes that provided significant protection (90-100% efficacy) in mouse models against both S. Paratyphi B sensu stricto and S. Paratyphi B Java challenge . This suggests that metabolic enzymes can be effective targets for attenuation in vaccine development, which could extend to NuoA-focused approaches.

Vaccine StrainMutationsRouteProtection Against Homologous StrainProtection Against Heterologous Strain
CVD 2005ΔguaBA ΔclpXIntranasal100%Not tested
CVD 2005ΔguaBA ΔclpXPeroral90%Significant
CVD 2003ΔguaBAVariousLower than CVD 2005Not reported

NuoA's potential as a vaccine target would require experimental validation through methods including:

  • Epitope mapping to identify immunogenic regions

  • In vitro and in vivo immunogenicity studies

  • Protection assays in animal models following immunization with NuoA-derived constructs

  • Analysis of cross-protection against different Salmonella serovars

What role might NuoA play in the differential pathogenesis between Salmonella paratyphi B biotypes?

The distinct clinical manifestations between Salmonella paratyphi B sensu stricto (causing systemic infection) and the Java biotype (causing gastroenteritis) likely involve metabolic adaptations that could involve NuoA function.

Research indicates that pathogenic differences between Salmonella serovars can be traced to genomic variations. For example, S. Typhi and S. Paratyphi A persistence in human macrophages is linked to the absence of 12 specific SPI2 effectors that target the NF-κB pathway, differentiating them from non-typhoidal Salmonella that rapidly induce apoptotic cell death .

To investigate NuoA's role in differential pathogenesis, researchers could:

  • Compare NuoA sequence and expression between sensu stricto and Java biotypes

  • Generate NuoA mutants in both biotypes and assess impacts on:

    • Cellular metabolism and energy production

    • Intracellular survival within macrophages

    • Host immune response modulation

    • Biofilm formation capacity

    • Persistence under stress conditions

Bioinformatic analysis could reveal whether sequence variations in NuoA correlate with the phylogenetic distinction between the two biotypes, potentially contributing to their differing disease presentations.

How does the structure and function of NuoA in Salmonella paratyphi B compare to homologous proteins in other pathogens?

A structural and functional comparative analysis of NuoA across different bacterial species can provide insights for targeted therapeutics:

Sequence Conservation Analysis:
The amino acid sequence of Salmonella paratyphi B NuoA shows conservation patterns that reflect its essential role in cellular respiration. Comparing this sequence against homologs in other pathogens and human mitochondrial complex I components could identify:

  • Highly conserved domains essential for electron transport function

  • Salmonella-specific regions that could be exploited for selective targeting

  • Structural motifs involved in assembly of the complete NADH-quinone oxidoreductase complex

Structural Comparison Approaches:

  • Homology modeling based on crystal structures of bacterial complex I from model organisms

  • Molecular dynamics simulations to analyze conformational dynamics

  • Protein-protein interaction analysis to understand subunit assembly differences

Functional Divergence Analysis:
Differences in NuoA function across species might manifest as variations in:

  • Electron transfer efficiency under different environmental conditions

  • Proton pumping capabilities affecting energy yield

  • Interactions with quinone substrates

  • Susceptibility to inhibitors

  • Contribution to membrane potential maintenance during host infection

Such comparative analyses could inform the development of narrow-spectrum antimicrobials targeting Salmonella-specific features of NuoA.

What are the optimized protocols for expressing and purifying recombinant Salmonella paratyphi B NuoA?

Based on established methodologies for membrane proteins and the specific parameters described for recombinant Salmonella proteins, the following optimized protocol is recommended:

Expression System Selection:

  • E. coli is typically used as the expression host for Salmonella proteins as indicated in product specifications

  • Expression vectors incorporating an N-terminal or C-terminal His-tag facilitate purification

  • Low-copy number vectors can help reduce toxicity issues common with membrane proteins

Optimized Expression Protocol:

  • Transform expression construct into E. coli BL21(DE3) or C43(DE3) (specialized for membrane proteins)

  • Culture in terrific broth supplemented with appropriate antibiotic

  • Grow at 37°C until OD600 reaches 0.6-0.8

  • Reduce temperature to 18-20°C before induction

  • Induce with low concentration IPTG (0.1-0.5 mM) for 16-20 hours

  • Harvest cells by centrifugation (5,000 × g, 15 min, 4°C)

Membrane Protein Purification Strategy:

  • Resuspend cell pellet in lysis buffer containing:

    • 50 mM Tris-HCl pH 8.0

    • 300 mM NaCl

    • 10% glycerol

    • Protease inhibitor cocktail

    • 1 mM PMSF

  • Disrupt cells using sonication or cell disruptor

  • Remove unbroken cells and debris (10,000 × g, 20 min, 4°C)

  • Isolate membrane fraction by ultracentrifugation (100,000 × g, 1 h, 4°C)

  • Solubilize membrane proteins with appropriate detergent (try DDM, LDAO, or C12E8)

  • Purify using nickel affinity chromatography

  • Further purify by size exclusion chromatography

Quality Control Assessments:

  • SDS-PAGE analysis to confirm >90% purity

  • Western blot using anti-His antibodies to verify identity

  • Mass spectrometry to confirm protein sequence

  • Circular dichroism to assess secondary structure integrity

  • Dynamic light scattering to evaluate homogeneity

This protocol should yield pure, properly folded NuoA protein suitable for downstream applications.

What methodologies can be used to study the interactions between NuoA and other subunits of the NADH-quinone oxidoreductase complex?

To investigate the assembly and interactions of NuoA within the NADH-quinone oxidoreductase complex, researchers can employ several complementary approaches:

Protein-Protein Interaction Assays:

  • Pull-down assays: Using His-tagged NuoA as bait to capture interacting partners from bacterial lysates, followed by mass spectrometry identification

  • Bacterial two-hybrid system: Testing direct interactions between NuoA and other respiratory complex subunits

  • Cross-linking mass spectrometry (XL-MS): Identifying proximity relationships between NuoA and neighboring subunits in the assembled complex

Structural Analysis Techniques:

  • Cryo-electron microscopy: For visualizing the entire complex architecture and determining NuoA's position within it

  • X-ray crystallography: If crystals of subcomplexes containing NuoA can be obtained

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Mapping interaction surfaces by identifying regions protected from solvent exchange

Functional Association Methods:

  • Co-expression studies: Expressing NuoA with other subunits to assess complex formation

  • Blue native PAGE: Separating intact respiratory complexes to evaluate assembly states

  • Enzyme activity reconstitution: Assessing how NuoA contributes to electron transfer by reconstituting activity with different subunit combinations

In silico Approaches:

  • Molecular docking: Predicting interaction interfaces between NuoA and other subunits

  • Coevolution analysis: Identifying co-evolving residues between subunits that may indicate interaction points

  • Molecular dynamics simulations: Studying the stability of predicted subunit interactions

These methodologies would provide comprehensive insights into how NuoA contributes to the structure and function of the complete NADH-quinone oxidoreductase complex.

How can researchers assess the functional activity of recombinant NuoA protein?

Assessing the functional activity of recombinant NuoA presents challenges as it normally functions as part of a multi-subunit complex. The following methodologies offer approaches to evaluate its functionality:

Reconstitution Approaches:

  • Proteoliposome reconstitution: Incorporate purified NuoA along with other complex I subunits into liposomes to recreate a membrane environment

  • Complementation of NuoA-deficient bacterial strains: Express recombinant NuoA in mutant strains lacking functional NuoA to assess functional recovery

Biophysical Activity Measurements:

  • NADH oxidation assay: While NuoA alone cannot catalyze NADH oxidation, its contribution to assembled subcomplexes can be measured spectrophotometrically at 340 nm

  • Artificial electron acceptor assays: Using electron acceptors like ferricyanide or dichlorophenolindophenol (DCIP) to measure electron transfer capability

  • Membrane potential measurements: Using voltage-sensitive dyes to detect proton pumping in reconstituted systems

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy: To confirm proper secondary structure folding

  • Thermal shift assays: To assess protein stability and potential ligand binding

  • Limited proteolysis: To evaluate whether the protein adopts a properly folded conformation resistant to partial digestion

Interaction Analysis:

  • Surface plasmon resonance (SPR): Measuring binding kinetics between NuoA and other subunits or ligands

  • Isothermal titration calorimetry (ITC): Quantifying thermodynamic parameters of interactions

  • Microscale thermophoresis (MST): Detecting biomolecular interactions based on changes in thermophoretic mobility

When interpreting results, it's important to consider that isolated NuoA may not exhibit its full native activity without the complete complex assembly. Comparative assays with whole complex preparations can provide context for interpreting results from the recombinant subunit studies.

How can researchers address contradictory data in NuoA functional studies?

When confronted with conflicting results in NuoA functional studies, researchers should employ a systematic approach to resolve contradictions:

Sources of Experimental Variation:

  • Protein production differences: Expression systems, purification methods, and storage conditions can affect protein activity and structure

  • Assay conditions: Buffer composition, pH, temperature, and presence of detergents can significantly impact membrane protein function

  • Genetic background effects: The same mutation may have different phenotypes in different strain backgrounds

Systematic Resolution Approach:

1. Standardize Experimental Conditions:

  • Use consistent protein preparations with documented purity and storage history

  • Establish standard assay conditions and record all experimental parameters

  • Implement positive and negative controls in all experiments

2. Cross-Validation Using Multiple Techniques:

  • Apply orthogonal methods to test the same hypothesis

  • For example, if electron transfer data is contradictory:

    • Combine spectroscopic assays with electrochemical measurements

    • Supplement biochemical assays with genetic complementation tests

    • Correlate in vitro findings with in vivo phenotypes

3. Statistical Analysis Framework:

  • Design experiments with sufficient replication (n≥3)

  • Apply appropriate statistical tests based on data distribution

  • Report effect sizes along with p-values to assess biological significance

4. Systematic Literature Review:

  • Create a structured comparison table of published findings:

StudyExperimental SystemMethodologyKey FindingsLimitationsPotential Confounding Factors
Study 1Recombinant NuoA in E. coliMembrane potential assaysFunction X observedLimited to in vitroDetergent effects
Study 2NuoA knockout in SalmonellaGrowth phenotypingFunction Y observedSingle strain backgroundPotential compensatory mutations
Study 3Structural analysisCryo-EMFunction Z proposedStatic structures onlyResolution limitations

5. Collaborative Validation:

  • Engage multiple laboratories to replicate key experiments using identical protocols

  • Organize round-robin studies for critical contradictory findings

  • Share reagents and experimental materials to eliminate preparation variables

By applying this structured approach, researchers can identify whether contradictions stem from methodological differences, biological variability, or represent genuinely different aspects of NuoA function in different contexts.

How might NuoA contribute to bacterial persistence during Salmonella paratyphi B infection?

Recent research has revealed mechanisms by which Salmonella serovars causing enteric fever persist within host cells, with implications for NuoA's potential role in this process:

Connection to Macrophage Persistence:
S. Typhi and S. Paratyphi A persist within human macrophages, whereas S. Typhimurium rapidly induces apoptotic cell death. This persistence is mediated through nuclear factor kappa B (NF-κB) dependent mechanisms . As a component of the electron transport chain, NuoA could contribute to persistence by:

  • Metabolic adaptation: Maintaining ATP production under the nutrient-limited conditions of the macrophage phagosome

  • Redox balance: Managing oxidative stress encountered within phagocytes

  • Membrane potential maintenance: Supporting bacterial survival mechanisms that require the proton motive force

Experimental Evidence from Related Salmonella Serovars:
Research has shown that S. Typhi and S. Paratyphi A lack 12 specific SPI2 effectors with pro-apoptotic functions, including nine that target NF-κB, allowing them to persist within macrophages . This suggests that metabolic adaptations, potentially involving NuoA, may be crucial for establishing chronic infections.

Proposed Research Strategy:
To investigate NuoA's role in persistence:

  • Generate conditional NuoA mutants in S. Paratyphi B

  • Assess intracellular survival within human macrophages

  • Monitor bacterial energy status during infection using ATP biosensors

  • Examine membrane potential maintenance under intracellular stress conditions

  • Compare NuoA expression patterns between actively replicating and persister cells

Understanding NuoA's contribution to bacterial persistence could reveal new therapeutic targets for eliminating chronic Salmonella infections.

How might NuoA serve as a target for novel antimicrobial strategies against Salmonella paratyphi B?

NADH-quinone oxidoreductase represents a promising target for antimicrobial development due to its essential role in bacterial energy metabolism. NuoA-focused strategies include:

Target Validation Approaches:

  • Demonstrate essentiality through conditional knockout studies

  • Establish correlation between NuoA inhibition and bacterial death

  • Verify minimal functional homology with human counterparts to ensure selectivity

Drug Discovery Strategies:

  • Structure-based design: Using structural models of NuoA to identify potential binding pockets

  • Fragment-based screening: Identifying small molecular fragments that bind to NuoA

  • Natural product screening: Testing compounds known to affect respiratory complexes

  • Repurposing approaches: Evaluating existing drugs that might interact with bacterial respiratory components

Innovative Targeting Approaches:

  • Subunit interaction disruptors: Compounds that prevent proper assembly of NuoA with other complex components

  • Allosteric modulators: Molecules that bind away from the active site but alter protein function

  • Covalent inhibitors: Compounds forming irreversible bonds with specific NuoA residues

  • Antimicrobial peptides: Designed to target NuoA-specific sequences or structures

Delivery Systems for Enhanced Efficacy:

  • Nanoparticle formulations for improved bioavailability

  • Prodrug approaches for targeted activation within bacteria

  • Combination therapies targeting multiple components of bacterial respiration

The development of NuoA inhibitors would benefit from the reported increase in paratyphoid fever cases and the emergence of antimicrobial resistance in Salmonella strains, underscoring the need for novel therapeutic approaches .

What are the key research priorities for advancing our understanding of NuoA in Salmonella paratyphi B?

Based on current knowledge gaps and emerging research trends, the following priorities should be considered for advancing NuoA research:

1. Structural Characterization:

  • Determine high-resolution structures of NuoA alone and in complex with neighboring subunits

  • Map the topology and membrane integration of NuoA in Salmonella

  • Identify potential drug-binding pockets unique to bacterial NuoA

2. Functional Analysis:

  • Establish the specific contribution of NuoA to electron transfer in the NADH-quinone oxidoreductase complex

  • Determine whether NuoA function differs between Salmonella paratyphi B sensu stricto and Java biotypes

  • Investigate potential moonlighting functions beyond respiratory metabolism

3. Host-Pathogen Interaction Studies:

  • Examine NuoA's role in bacterial adaptation to host environments

  • Investigate whether NuoA activity influences immune response during infection

  • Determine if NuoA contributes to the persistent infection characteristic of enteric fever

4. Therapeutic Development:

  • Conduct high-throughput screens for NuoA inhibitors

  • Evaluate NuoA as a potential vaccine component

  • Explore combination approaches targeting multiple respiratory complex subunits

5. Genomic and Evolutionary Analysis:

  • Perform comprehensive comparative genomics of NuoA across Salmonella lineages

  • Investigate horizontal gene transfer events affecting the nuo operon

  • Identify selective pressures shaping NuoA evolution in different hosts

By addressing these research priorities, scientists will gain deeper insights into the fundamental biology of Salmonella paratyphi B and potentially develop new strategies for diagnosing, preventing, and treating paratyphoid fever.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.