Recombinant Salmonella paratyphi B p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its implementation.
Synonyms
aaeA; SPAB_04193; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
aaeA
Target Protein Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITH VNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGS TAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTS DAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFR KLAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

What is the functional role of the AaeA protein in Salmonella paratyphi B?

The AaeA protein is a subunit of the AaeAB efflux pump system, which functions to expel aromatic carboxylic acids such as p-hydroxybenzoic acid (pHBA) from bacterial cells . This system is regulated by the LysR-type transcriptional activator AaeR, which responds to pHBA as an inducer . The pump’s physiological role is hypothesized to act as a metabolic relief valve, mitigating toxicity from imbalanced metabolic byproducts .

Gene/ProteinFunctionInducer
AaeA (aaeA)Efflux pump subunit (membrane-associated)pHBA
AaeB (aaeB)Efflux pump subunit (periplasmic bridge)pHBA
AaeR (aaeR)LysR-type regulatorpHBA

What experimental approaches validate the efflux function of AaeA?

To confirm AaeA’s efflux activity:

  • qPCR/Western blot: Measure aaeA expression under pHBA induction .

  • Efflux assays: Compare pHBA accumulation in wild-type vs. ΔaaeA mutants .

  • Structural analysis: Use cryo-EM or X-ray crystallography to study AaeA’s conformational changes during substrate transport.

Advanced Research Questions

How does the recombinant AaeA protein differ from its native form?

The recombinant AaeA (UniProt ID: A9N863) is expressed in E. coli with an N-terminal His-tag for purification . Key differences include:

  • Post-translational modifications: Native AaeA may undergo lipidation or phosphorylation absent in recombinant systems.

  • Membrane integration: Proper folding in E. coli requires optimization to mimic the Salmonella membrane environment.

  • Oligomerization: Native AaeA likely forms heterotrimeric complexes (AaeA-AaeB) for efflux function, which must be reconstituted in vitro .

What challenges exist in studying AaeA’s substrate specificity?

Substrate profiling requires:

  • Competition assays: Test pHBA transport inhibition by structural analogs.

  • Mutagenesis: Identify critical residues via alanine scanning (e.g., Tyr153, Arg219 in AaeA).

  • Flux measurements: Quantify efflux rates using radiolabeled pHBA or fluorescent analogs.

Assay TypePurposeLimitations
Whole-cell assaysAssess net efflux in live cellsMasked by competing transport systems
Liposome reconstitutionIsolate AaeAB activityRequires proper membrane protein folding
Yeast two-hybridIdentify interaction partnersLimited to cytoplasmic interactions

How to design experiments addressing contradictions in efflux data?

Discrepancies in efflux studies may arise from:

  • Experimental conditions: Verify pH, temperature, and pHBA concentration gradients.

  • Protein purity: Confirm AaeA’s homogeneity via SDS-PAGE and LC-MS .

  • Host strain effects: Compare Salmonella vs. E. coli expression systems.

What role does AaeA play in antibiotic resistance?

While AaeAB primarily targets pHBA, structural similarities to multidrug resistance (MDR) pumps suggest broader substrate potential. Researchers should:

  • Screen for antibiotic substrates: Test AaeA’s ability to efflux β-lactams, tetracyclines, or fluoroquinolones.

  • Evolutionary analysis: Compare AaeA to homologs in Salmonella Typhi or Enterobacter spp.

Methodological Considerations

How to optimize recombinant AaeA production?

FactorOptimization Strategy
Expression vectorChoose high-copy plasmids (e.g., pET28a)
Induction conditionsTest IPTG concentrations (0.1–1 mM) and induction times (4–16 hr)
PurificationUse nickel affinity chromatography followed by size-exclusion to remove aggregates

What data analysis pipelines are recommended?

For efflux assays:

  • Kinetic modeling: Fit transport curves to Michaelis-Menten equations.

  • Statistical validation: Use ANOVA to compare mutant vs. wild-type strains.

  • Bioinformatics: Align AaeA sequences to predict conserved efflux motifs (e.g., Walker A/B motifs).

Key Takeaways

  • Functional validation: Prioritize substrate-specific assays over generic protein expression studies.

  • System integration: Study AaeAB in conjunction with other efflux systems (e.g., AcrAB-TolC).

  • Structural biology: Cryo-EM of AaeA-AaeB complexes is critical for mechanistic insights.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.