Recombinant Salmonella paratyphi B Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

What is the complete amino acid sequence of Recombinant Salmonella paratyphi B ArnE protein?

The full amino acid sequence of the Recombinant Salmonella paratyphi B ArnE protein consists of 111 amino acids as follows:

MIGVVLVLASLLSVGGQLCQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIIILGSAA

This represents the complete protein sequence (residues 1-111), which is typically expressed with an N-terminal His-tag when produced as a recombinant protein for research purposes. The sequence information is critical for structure-function relationship studies, epitope mapping, and antibody development.

What is the predicted membrane topology of the ArnE protein and how does it relate to its function?

The ArnE protein is predicted to be a membrane protein with multiple transmembrane domains, as suggested by its highly hydrophobic amino acid sequence. Analysis of the sequence reveals multiple hydrophobic regions consistent with a membrane-spanning protein architecture. The ArnE subunit functions as part of a flippase complex involved in translocating 4-amino-4-deoxy-L-arabinose-modified lipid molecules across bacterial membranes .

The membrane topology is integral to its function as a flippase subunit, where it contributes to the translocation of undecaprenyl phosphate-linked aminoarabinose from the cytoplasmic to the periplasmic face of the inner membrane during lipopolysaccharide modification. This process is particularly significant for antimicrobial resistance mechanisms in Salmonella species.

What are the alternative names and classifications for the ArnE protein?

The ArnE protein is known by several alternative names in scientific literature and databases:

This protein is classified as a membrane transport protein, specifically a flippase subunit involved in lipopolysaccharide modification pathways .

What are the optimal storage and reconstitution conditions for recombinant ArnE protein?

For optimal storage and handling of recombinant ArnE protein, the following protocol is recommended:

Storage:

• Store lyophilized powder at -20°C/-80°C upon receipt

• For extended storage, maintain at -20°C or -80°C

• Avoid repeated freeze-thaw cycles as this may compromise protein integrity

• Working aliquots can be stored at 4°C for up to one week

Reconstitution:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is recommended as default)

• Prepare small aliquots for long-term storage at -20°C/-80°C

The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during storage and reconstitution processes.

What purification methods are most effective for isolating ArnE protein while maintaining its native conformation?

The most effective purification strategy for isolating ArnE protein while preserving its native conformation involves a multi-step approach tailored to membrane proteins:

• Expression system optimization: Using E. coli as an expression host with appropriate membrane protein expression vectors containing His-tags for purification

• Membrane isolation and solubilization:

  • Careful cell lysis using techniques that preserve membrane integrity

  • Differential centrifugation to isolate membrane fractions

  • Solubilization using mild detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) that maintain protein structure

• Affinity chromatography:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar matrices to capture His-tagged protein

  • Gradient elution with imidazole to minimize co-purification of contaminants

• Secondary purification:

  • Size exclusion chromatography to separate oligomeric states and remove aggregates

  • Ion exchange chromatography for additional purification if necessary

This approach typically yields recombinant ArnE protein with greater than 90% purity as determined by SDS-PAGE analysis .

How can researchers verify the functional activity of purified recombinant ArnE protein?

Verifying the functional activity of purified recombinant ArnE protein presents unique challenges due to its role as a membrane flippase subunit. Several complementary approaches can be employed:

• Liposome reconstitution assays:

  • Incorporation of purified ArnE into artificial liposomes

  • Measuring the translocation of fluorescently labeled lipid analogs across the membrane

  • Monitoring changes in membrane permeability or potential

• Protein-protein interaction studies:

  • Co-immunoprecipitation with known interaction partners in the Arn pathway

  • Surface plasmon resonance (SPR) to measure binding kinetics with pathway components

  • Bacterial two-hybrid systems to verify interactions in vivo

• Complementation studies:

  • Expression of recombinant ArnE in ArnE-deficient bacterial strains

  • Assessing restoration of aminoarabinose modification of lipopolysaccharide

  • Measuring changes in antimicrobial peptide resistance as a functional readout

• Structural integrity verification:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure content

  • Limited proteolysis to assess proper folding

  • Thermal shift assays to determine protein stability

These methods collectively provide a comprehensive assessment of both structural integrity and functional capacity of the purified recombinant ArnE protein.

How does ArnE contribute to antimicrobial resistance mechanisms in Salmonella paratyphi B?

ArnE plays a crucial role in antimicrobial resistance mechanisms in Salmonella paratyphi B through its function in lipopolysaccharide (LPS) modification:

• Aminoarabinose incorporation pathway:

  • ArnE forms part of the flippase complex that translocates 4-amino-4-deoxy-L-arabinose (L-Ara4N) from the cytoplasmic to the periplasmic face of the inner membrane

  • This allows for the subsequent incorporation of L-Ara4N into lipid A, the anchor of LPS

• Charge modification of LPS:

  • The addition of L-Ara4N to lipid A reduces the negative charge of the bacterial outer membrane

  • This modification decreases the electrostatic attraction between positively charged antimicrobial peptides and the bacterial surface

• Resistance consequences:

  • Reduced binding of cationic antimicrobial peptides (CAMPs) such as polymyxins and host defense peptides

  • Increased survival in the presence of these antimicrobials

  • Potential cross-resistance to other cationic antibiotics

• Regulatory control:

  • Expression of arnE and related genes is typically upregulated in response to environmental signals such as low Mg²⁺ or the presence of antimicrobial peptides

  • This regulation often occurs through two-component systems like PhoP/PhoQ and PmrA/PmrB

This LPS modification system represents a significant virulence and survival mechanism, particularly relevant in the context of emerging antimicrobial resistance in clinical Salmonella isolates.

What experimental approaches can differentiate between the roles of ArnE and other related flippase components?

Differentiating the specific contributions of ArnE from other related flippase components requires sophisticated experimental approaches:

• Genetic manipulation strategies:

  • Generation of clean deletion mutants for arnE and related genes (arnF, arnT)

  • Construction of complementation strains with controlled expression

  • Creation of chimeric proteins to identify functional domains

  • Site-directed mutagenesis of conserved residues to pinpoint critical amino acids

• Biochemical characterization:

  • Reconstitution of defined combinations of purified Arn pathway components

  • In vitro flippase assays using fluorescent or radiolabeled substrates

  • Crosslinking studies to capture transient protein-protein interactions

  • Mass spectrometry to identify protein complexes and their stoichiometry

• Advanced imaging techniques:

  • Super-resolution microscopy to visualize the localization and dynamics of ArnE

  • Single-molecule tracking to monitor protein movement within membranes

  • FRET-based approaches to detect conformational changes during substrate transport

• Computational methods:

  • Molecular dynamics simulations to model flippase function

  • Structure prediction and docking studies to understand protein-substrate interactions

  • Systems biology approaches to model pathway flux and regulation

These complementary approaches allow researchers to dissect the specific contributions of ArnE within the context of the complete aminoarabinose modification pathway.

How do the molecular properties of ArnE differ between systemic and enteric pathovars of Salmonella paratyphi B?

The molecular properties of ArnE may exhibit important differences between systemic pathovar (SPV) and enteric pathovar (EPV) strains of Salmonella paratyphi B, reflecting their distinct pathogenic mechanisms:

• Genetic diversity and expression patterns:

  • SPV strains demonstrate more genetic homogeneity in virulence-associated genes compared to the more diverse EPV strains

  • Potential differences in arnE expression levels or regulation between pathovars may contribute to their distinct tissue tropism and disease manifestations

• Functional integration with other virulence factors:

  • SPV strains show a distinctive pattern of effector protein genes including sopB, sopD, sopE1, avrA, and sptP

  • The interaction between ArnE-mediated LPS modifications and these effector proteins may differ between pathovars

  • ArnE function may be differentially coordinated with type III secretion systems in the two pathovars

• Response to environmental signals:

  • SPV strains likely maintain ArnE activity under the conditions encountered during systemic infection

  • EPV strains may show different regulation of ArnE in response to intestinal environmental cues

• Evolutionary implications:

  • Comparative genomic analysis suggests pathovar-specific genetic elements that may influence ArnE function

  • PCR techniques targeting specific virulence genes like sopE1 and avrA help distinguish between pathovars

While direct experimental evidence specifically comparing ArnE between these pathovars is limited in the literature, the known distinctive properties of systemic versus enteric Salmonella paratyphi B strains suggest potentially important differences in ArnE regulation, expression, or functional integration with other virulence mechanisms.

What are the most common challenges in expressing recombinant ArnE protein and how can they be addressed?

Expressing recombinant ArnE protein presents several challenges common to membrane proteins, along with specific considerations:

• Toxicity to expression hosts:

  • Challenge: Overexpression of membrane proteins often leads to host cell toxicity

  • Solution: Use tightly regulated inducible expression systems (e.g., pET with T7 lysozyme co-expression)

  • Solution: Employ specialized E. coli strains designed for membrane protein expression (C41/C43)

  • Solution: Optimize induction conditions (lower temperature, reduced inducer concentration)

• Protein misfolding and aggregation:

  • Challenge: Membrane proteins tend to aggregate in inclusion bodies

  • Solution: Express as fusion proteins with solubility-enhancing tags (MBP, SUMO)

  • Solution: Include specific detergents or lipids in lysis buffers

  • Solution: Use mild solubilization conditions to recover properly folded protein

• Low yield:

  • Challenge: Membrane proteins typically express at lower levels than soluble proteins

  • Solution: Scale up culture volumes to compensate for lower per-cell yield

  • Solution: Optimize codon usage for the expression host

  • Solution: Test different growth media formulations and induction protocols

• Purification difficulties:

  • Challenge: Maintaining protein stability during extraction from membranes

  • Solution: Screen multiple detergents for optimal extraction efficiency and protein stability

  • Solution: Include stabilizing agents (glycerol, specific lipids) throughout purification

  • Solution: Minimize time between extraction and final storage/application

Researchers should consider implementing a systematic optimization strategy, testing multiple expression constructs, host strains, and purification conditions to identify the optimal approach for their specific research needs.

How can researchers design experiments to study the interaction between ArnE and its substrate 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol?

Designing experiments to study the interaction between ArnE and its substrate requires specialized approaches suitable for membrane protein-lipid interactions:

• Binding assays:

  • Surface plasmon resonance (SPR) with immobilized ArnE and flowing substrate

  • Microscale thermophoresis (MST) to measure binding in solution

  • Fluorescence-based assays using labeled substrate analogs

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters of binding

• Structural approaches:

  • Hydrogen-deuterium exchange mass spectrometry to identify substrate interaction sites

  • Cysteine accessibility methods to map conformational changes upon substrate binding

  • Cryo-electron microscopy of ArnE in nanodiscs or other membrane mimetics with bound substrate

  • Computational docking and molecular dynamics simulations to predict binding mode

• Functional reconstitution:

  • Proteoliposome-based flipping assays with fluorescently labeled substrate analogs

  • Development of coupled enzymatic assays to monitor transport activity

  • Counter-flow assays to assess specificity of transport

• Mutagenesis approaches:

  • Alanine scanning of predicted substrate-binding regions

  • Modification of substrate analogs to probe structure-activity relationships

  • Creation of photocrosslinkable substrate analogs to capture transient binding states

The experimental design should incorporate appropriate controls including ArnE mutants with impaired function and structurally similar but non-transported lipid analogs to confirm specificity of the observed interactions.

What considerations should be made when designing PCR-based detection methods for arnE gene variants across different Salmonella strains?

When designing PCR-based detection methods for arnE gene variants across different Salmonella strains, researchers should consider several critical factors:

• Primer design considerations:

  • Target conserved regions of the arnE gene to ensure reliable amplification

  • Perform sequence alignments of arnE from multiple Salmonella strains to identify suitable targets

  • Consider designing degenerate primers if sequence variability exists

  • Include positive controls targeting highly conserved Salmonella genes (e.g., invA)

• Assay validation:

  • Test primers against a diverse panel of Salmonella paratyphi B isolates including both systemic and enteric pathovars

  • Include closely related non-target species to confirm specificity

  • Optimize PCR conditions (annealing temperature, Mg²⁺ concentration) for maximum sensitivity and specificity

  • Consider quantitative PCR approaches for improved sensitivity and quantification

• Multiplex PCR design:

  • Design multiplex PCR assays targeting arnE alongside other distinguishing genetic markers

  • Include pathovar-specific markers such as sopE1 and avrA genes to differentiate systemic from enteric strains

  • Ensure primer sets are compatible in terms of annealing temperature and amplicon size

• Clinical and epidemiological applications:

  • Consider extraction methods optimized for different sample types (clinical, environmental, food)

  • Develop internal amplification controls to detect PCR inhibition

  • Establish appropriate reference standards for quantitative assays

  • Validate the correlation between PCR results and relevant phenotypes (e.g., antimicrobial resistance)

The PCR design should be tailored to the specific research objective, whether it's simple detection, strain typing, or quantitative analysis of gene expression, with appropriate consideration of the genetic diversity present in clinical and environmental Salmonella isolates.

What biosafety considerations and NIH guidelines apply when working with recombinant Salmonella paratyphi B ArnE?

Working with recombinant Salmonella paratyphi B ArnE requires careful attention to biosafety regulations and compliance with established guidelines:

• Risk assessment and biosafety level determination:

  • Salmonella paratyphi B is typically classified as a Risk Group 2 pathogen

  • Work involving recombinant DNA in Risk Group 2 organisms generally requires Biosafety Level 2 (BSL-2) containment

  • Experiments using Salmonella paratyphi B as a host-vector system fall under Section III-D of the NIH Guidelines

• NIH Guidelines compliance requirements:

  • Institutional Biosafety Committee (IBC) approval is required PRIOR to initiation of experiments

  • Specific protocols for working with Risk Group 2 agents must be followed

  • Proper documentation and registration of all recombinant DNA experiments

• Laboratory safety practices:

  • Use of biological safety cabinets for all manipulations that may generate aerosols

  • Implementation of proper decontamination procedures for all waste

  • Restricted laboratory access during experimental procedures

  • Use of appropriate personal protective equipment (laboratory coat, gloves, eye protection)

• Special considerations:

  • If experiments involve transfer of drug resistance traits, additional approvals may be required under Section III-A or III-B of the NIH Guidelines

  • Projects involving cloning of virulence factors or genes that could alter pathogenicity may require additional review

Researchers must register their work through their institutional Environmental Health and Safety or similar department and maintain compliance with all local, state, and federal regulations governing work with recombinant organisms.

How should researchers address potential contamination concerns when working with recombinant ArnE protein in laboratory settings?

Addressing contamination concerns when working with recombinant ArnE protein requires implementation of comprehensive control measures:

• Prevention strategies:

  • Dedicated workspace and equipment for recombinant protein work

  • Regular decontamination of work surfaces with appropriate disinfectants

  • Implementation of unidirectional workflow from clean to potentially contaminated areas

  • Use of filtered pipette tips and sterile consumables

• Quality control measures:

  • Regular testing of expression systems for contamination

  • Endotoxin testing of final protein preparations

  • Verification of protein purity by multiple methods (SDS-PAGE, mass spectrometry)

  • Microbial sterility testing of purified protein preparations

• Documentation and monitoring:

  • Maintenance of detailed records for all protein preparation batches

  • Implementation of lot tracking for all reagents used

  • Regular environmental monitoring of laboratory spaces

  • Establishment of acceptance criteria for protein purity and sterility

• Personnel training and oversight:

  • Comprehensive training in aseptic technique

  • Regular refresher training on contamination control procedures

  • Supervision of new personnel by experienced researchers

  • Implementation of a quality management system with regular audits

These measures help ensure the integrity of research results while maintaining compliance with safety regulations and protecting both personnel and the environment from potential exposure to recombinant materials.

How can structural studies of ArnE contribute to the development of novel antimicrobial strategies?

Structural studies of ArnE offer substantial potential for developing novel antimicrobial strategies through several mechanisms:

• Structure-based drug design:

  • Determination of high-resolution structures of ArnE using techniques such as X-ray crystallography, cryo-electron microscopy, or NMR

  • Identification of potential binding pockets for small molecule inhibitors

  • Virtual screening and molecular docking to identify lead compounds

  • Structure-activity relationship studies to optimize inhibitor binding and selectivity

• Targeting LPS modification pathways:

  • Designing inhibitors that block ArnE-mediated flippase activity

  • Preventing aminoarabinose incorporation into lipid A, thereby increasing bacterial susceptibility to polymyxins and other cationic antimicrobial peptides

  • Developing combination therapies that synergize with existing antibiotics by blocking resistance mechanisms

• Rational vaccine design:

  • Identification of exposed epitopes that could serve as targets for vaccine development

  • Engineering of immunogenic constructs that elicit antibodies against critical functional domains

  • Design of attenuated vaccine strains with modified ArnE function

• Novel diagnostic approaches:

  • Development of antibodies or aptamers targeting ArnE for detection of resistant Salmonella strains

  • Creating biosensors that can identify pathovar-specific molecular patterns

The potential impact of these approaches extends beyond Salmonella paratyphi B to other Gram-negative pathogens that utilize similar LPS modification systems for antimicrobial resistance, potentially addressing the growing global challenge of multidrug-resistant infections.

What role does ArnE play in the differential virulence between systemic and enteric Salmonella paratyphi B strains?

The potential role of ArnE in the differential virulence between systemic and enteric Salmonella paratyphi B strains represents an important area for investigation:

• Pathogenicity differences:

  • Systemic pathovar (SPV) strains cause paratyphoid fever with systemic dissemination

  • Enteric pathovar (EPV) strains typically cause localized gastroenteritis

  • These distinct clinical presentations suggest fundamental differences in virulence mechanisms

• Potential ArnE contributions:

  • Differential regulation or expression of arnE between pathovars may influence resistance to host antimicrobial peptides in different tissue environments

  • Variations in ArnE structure or function could impact survival within different host cell types (macrophages vs. epithelial cells)

  • Coordination between LPS modification systems and other virulence factors may differ between pathovars

• Experimental approaches to investigate this role:

  • Comparative transcriptomic and proteomic analysis of ArnE expression between pathovars

  • Creation of isogenic mutants with arnE deletions or replacements between pathovars

  • In vivo infection models comparing wild-type and ArnE-modified strains

  • Analysis of LPS modification patterns in response to host environmental cues

• Integration with known pathovar differences:

  • SPV strains exhibit distinctive patterns of effector protein genes (sopB, sopD, sopE1, avrA, sptP) that could interact functionally with ArnE-mediated LPS modifications

  • PCR-based diagnostic techniques targeting sopE1 and avrA genes help distinguish pathovars and could be expanded to include arnE analysis

This research area has significant implications for understanding Salmonella pathogenesis and could potentially inform new approaches for diagnosis, treatment, and prevention of different clinical manifestations of Salmonella paratyphi B infections.

How can comparative genomic approaches enhance our understanding of ArnE evolution across Salmonella species?

Comparative genomic approaches offer powerful methods to understand ArnE evolution across Salmonella species and strains:

• Phylogenetic analysis:

  • Construction of phylogenetic trees based on arnE sequences from diverse Salmonella isolates

  • Identification of conserved and variable regions within the gene

  • Correlation of sequence variations with serotype, host range, and virulence characteristics

  • Analysis of selection pressures acting on different regions of the protein

• Synteny and genomic context:

  • Examination of the genomic neighborhood surrounding arnE across different Salmonella lineages

  • Identification of co-evolved gene clusters that may functionally interact with ArnE

  • Analysis of mobile genetic elements that may have contributed to horizontal gene transfer

  • Comparison with related enterobacterial species to identify Salmonella-specific features

• Structural and functional prediction:

  • Homology modeling based on conserved domains

  • Identification of critical residues through conservation analysis

  • Prediction of functional motifs and their evolutionary conservation

  • Correlation of sequence polymorphisms with antimicrobial resistance phenotypes

• Integration with experimental data:

  • Combining genomic analysis with experimental validation of predicted functional differences

  • Testing hypotheses generated from comparative genomics using targeted mutations

  • Correlation of genomic features with transcriptomic and proteomic datasets

  • Development of diagnostic tools based on identified sequence signatures

This multifaceted approach can reveal how ArnE has evolved in response to selective pressures, including host adaptation and antimicrobial exposure, potentially identifying novel targets for intervention and diagnostic markers for clinically relevant Salmonella strains.