Recombinant Salmonella paratyphi B Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella paratyphi B Probable Ubiquinone Biosynthesis Protein UbiB (ubiB)

The Recombinant Salmonella paratyphi B Probable Ubiquinone Biosynthesis Protein UbiB (ubiB) is a recombinant protein derived from the bacterium Salmonella paratyphi B. This protein is involved in the biosynthesis of ubiquinone, also known as coenzyme Q, which plays a crucial role in the electron transport chain and energy production within cells. The recombinant form of this protein is expressed in Escherichia coli and is tagged with a His-tag for easier purification and identification.

Key Features of Recombinant Salmonella paratyphi B UbiB Protein

  • Species: Salmonella paratyphi B

  • Source: Expressed in E. coli

  • Tag: N-terminal His-tag

  • Protein Length: Full-length, 546 amino acids

  • Form: Lyophilized powder

  • Purity: Greater than 90% as determined by SDS-PAGE

Role of UbiB in Ubiquinone Biosynthesis

UbiB is part of the ubiquinone biosynthesis pathway, which is essential for the production of coenzyme Q. This pathway involves several enzymes that convert simple precursors into the complex coenzyme Q molecule. In bacteria like Salmonella paratyphi B, UbiB is crucial for the monooxygenase steps in the biosynthesis process. Mutations in the ubiB gene can lead to the accumulation of intermediates such as octaprenylphenol, indicating its importance in completing the biosynthetic pathway .

Biosynthesis Pathway Involvement

Enzyme/ProteinRole in Biosynthesis
UbiEC-methyltransferase
UbiJ (YigP)Required for Q8 biosynthesis under aerobic conditions
UbiBMonooxygenase step

Research Findings and Implications

Recent studies have highlighted the role of UbiB family proteins in regulating cellular coenzyme Q distribution, particularly in yeast models . While the specific function of Salmonella paratyphi B UbiB in coenzyme Q distribution is less explored, its involvement in ubiquinone biosynthesis suggests potential implications for bacterial energy metabolism and virulence.

Potential Functions of UbiB

  • Ubiquinone Biosynthesis: Essential for the production of coenzyme Q, which is vital for bacterial energy metabolism.

  • Protein Kinase Activity: Speculated to have kinase activity, potentially regulating ubiquinone biosynthesis through phosphorylation .

  • Bacterial Virulence: Coenzyme Q biosynthesis is linked to bacterial intracellular proliferation in macrophages, suggesting a role in virulence .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet your specific needs.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; SPAB_04928; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
ubiB
Target Protein Sequence
MTPGEVRRLYFIIRTFLSYGLDELIPRMRLTLPLRLWRYSLFWMPNRHKDKLLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGRLAKAQIEEAMGGLPVEA WFDDFDIQPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIQADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFENSPMLYIPEVYSDYCSQNM MVMERIYGIPVSDVAALEKNGTNMKLLAERGVKVFFTQVFRDSFFHADMHPGNIFVSHEH PENPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEDFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWVEKMPEIPELVYDSLRQGKYLQH SVDKIARELQVNHVRQSQSRYLLGIGATLLLSGSFLLVNRPEWGLMPGWLMVGGVVVWLV GWRKTR
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ubiquinone biosynthesis protein UbiB and what is its role in Salmonella paratyphi B?

UbiB is a protein involved in the biosynthesis pathway of ubiquinone (coenzyme Q), which functions as an electron carrier in aerobic respiration. In Salmonella paratyphi B, UbiB is classified as a "probable" ubiquinone biosynthesis protein, with its function predicted through computational methods but requiring further experimental validation. According to protein information databases, the full-length protein consists of 546 amino acids with a predicted molecular function in the ubiquinone biosynthetic process .

The protein's role appears to be within the traditional O₂-dependent pathway for ubiquinone synthesis, which is essential for bacterial respiration under aerobic conditions. Studies on related pathways suggest that UbiB likely participates in hydroxylation reactions during ubiquinone precursor modifications, though the specific reaction catalyzed by UbiB remains to be fully characterized.

How does UbiB differ from other ubiquinone biosynthesis proteins like UbiU, UbiV, and UbiT?

While UbiB functions within the classic O₂-dependent ubiquinone biosynthesis pathway, research has identified a novel O₂-independent pathway involving UbiU, UbiV, and UbiT proteins that enables bacteria to synthesize ubiquinone even in anaerobic environments . The key differences include:

  • Oxygen requirements: UbiB is part of a pathway requiring molecular oxygen as a substrate, whereas UbiU, UbiV, and UbiT function in an O₂-independent manner.

  • Protein structure and function: UbiU and UbiV form a heterodimer complex, with each protein binding a 4Fe-4S cluster via conserved cysteine residues that are essential for their hydroxylase activity. UbiT contains an SCP2 lipid-binding domain and likely serves as an accessory factor in the biosynthetic pathway .

  • Evolutionary distribution: The UbiT, UbiU, and UbiV proteins are found in alpha-, beta-, and gammaproteobacterial clades, including several human pathogens, supporting a widespread distribution of the O₂-independent ubiquinone biosynthesis capacity .

What is the significance of the O₂-independent ubiquinone biosynthesis pathway discovered in proteobacteria and how might it relate to UbiB function?

The discovery of an O₂-independent pathway for ubiquinone biosynthesis represents a significant advancement in understanding bacterial adaptation to varying oxygen conditions . This pathway has several important implications:

  • Metabolic plasticity: The presence of both O₂-dependent (UbiB-containing) and O₂-independent (UbiUVT) pathways enables bacteria to synthesize ubiquinone across the entire O₂ range, providing remarkable metabolic flexibility for adaptation to environments with fluctuating oxygen levels.

  • Pathogen survival: This dual pathway system likely contributes to the ability of pathogenic bacteria, including Salmonella species, to colonize diverse host environments with variable oxygen tensions, such as different regions of the intestinal tract.

  • Evolutionary advantage: Research indicates that the O₂-independent pathway is essential for nitrate respiration and uracil biosynthesis under anaerobiosis, while also contributing to bacterial multiplication in the mouse gut . This suggests complementary roles for the two pathways under different environmental conditions.

  • Regulatory networks: The O₂-independent pathway genes (ubiT, ubiU, ubiV) are transcribed as two divergent operons under the control of the O₂-sensing Fnr transcriptional regulator , suggesting sophisticated regulatory mechanisms that coordinate pathway selection based on oxygen availability.

Understanding the relationship between UbiB and the UbiUVT system provides insights into how bacteria optimize their respiratory metabolism across different environmental conditions, which has implications for pathogenesis and bacterial adaptation strategies.

How do UbiU-UbiV hydroxylases represent a novel class of O₂-independent enzymes compared to traditional hydroxylation mechanisms?

UbiU and UbiV represent a groundbreaking class of O₂-independent hydroxylases that challenge traditional understanding of hydroxylation reactions in biochemistry . The distinctive features include:

  • Iron-sulfur clusters: Each protein in the UbiU-UbiV heterodimer binds a 4Fe-4S cluster via conserved cysteine residues, which is essential for hydroxylase activity. This is in contrast to the heme or non-heme iron centers typically found in O₂-dependent monooxygenases and dioxygenases.

  • Oxygen source: While conventional hydroxylases incorporate oxygen atoms directly from molecular O₂, the UbiU-UbiV system must derive oxygen atoms from alternative sources, likely water or other oxygen-containing molecules. Studies using ¹⁸O₂ labeling have confirmed the O₂-independent nature of these reactions .

  • Electron transfer mechanism: The 4Fe-4S clusters likely facilitate a unique electron transfer mechanism that enables hydroxylation without requiring molecular oxygen as an electron acceptor.

  • Substrate specificity: The UbiU-UbiV system appears to have evolved specificity for ubiquinone precursors, highlighting specialized adaptation for maintaining respiratory function under anaerobic conditions.

This novel hydroxylation mechanism represents a significant advancement in our understanding of enzyme catalysis and provides new perspectives on the evolutionary strategies bacteria have developed to overcome environmental constraints.

What are the best methods for expressing and purifying recombinant UbiB from Salmonella paratyphi B for biochemical studies?

Effective expression and purification of recombinant UbiB require careful consideration of several factors:

  • Expression system selection:

    • Bacterial expression: E. coli BL21(DE3) or similar strains are recommended for expressing prokaryotic proteins like UbiB

    • Vector design: Include the full-length sequence (amino acids 1-546) with an appropriate purification tag

    • Induction conditions: Optimize temperature, IPTG concentration, and induction time to maximize soluble protein yield

  • Purification strategy:

    • Initial capture: Affinity chromatography using the engineered tag (His, GST, etc.)

    • Further purification: Size exclusion chromatography to remove aggregates and contaminants

    • Buffer optimization: A Tris-based buffer system with appropriate pH (7.0-8.0) based on protein properties

  • Storage conditions:

    • Long-term storage: -20°C or -80°C in Tris-based buffer containing 50% glycerol

    • Working stocks: Aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles which can compromise protein integrity

  • Quality control:

    • SDS-PAGE and western blot to confirm purity and identity

    • Mass spectrometry to verify sequence integrity

    • Initial activity assays to confirm proper folding and function

These methodological considerations are essential for obtaining high-quality recombinant protein suitable for downstream biochemical and structural studies.

How can PCR methods be used to identify and study Salmonella paratyphi B strains expressing UbiB?

PCR-based approaches offer powerful tools for identifying and studying Salmonella paratyphi B strains expressing UbiB:

  • Strain identification through multiplex PCR:

    • First multiplex PCR to identify serogroup B strains (to which S. paratyphi B belongs)

    • Second PCR to confirm flagellar antigen "b" characteristic of Paratyphi B

    • This two-step approach has demonstrated 100% sensitivity and specificity in clinical isolate identification

  • UbiB gene detection and analysis:

    • Design primers specific to the ubiB gene (SPAB_04928) using the sequence information

    • Develop PCR conditions optimized for specificity and sensitivity

    • Include appropriate positive and negative controls to validate results

  • Expression analysis:

    • RT-PCR or quantitative real-time PCR to assess ubiB transcript levels

    • Design internal controls amplifying housekeeping genes for normalization

    • Analyze expression under different environmental conditions (varying oxygen levels, growth phases, etc.)

  • Genetic manipulation:

    • Design primers with appropriate restriction sites or homology regions for gene knockout or modification

    • Construct mutant strains to assess UbiB function through complementation studies

    • Create reporter gene fusions to monitor expression patterns in vivo

These PCR-based approaches provide reliable, high-throughput methods for studying UbiB in S. paratyphi B strains from various sources, enabling both basic characterization and complex functional analyses.

How should researchers analyze and interpret changes in UbiB expression under different oxygen conditions?

Analysis and interpretation of UbiB expression changes under different oxygen conditions require a comprehensive approach:

  • Experimental design considerations:

    • Establish strictly controlled oxygen conditions (aerobic, microaerobic, anaerobic)

    • Include appropriate transition periods to capture dynamic responses

    • Consider growth phase effects, as respiratory requirements change during bacterial growth cycle

  • Expression analysis methodology:

    • Quantitative RT-PCR targeting ubiB with appropriate reference genes stable under varying oxygen conditions

    • Western blotting with anti-UbiB antibodies for protein-level analysis

    • Consider global approaches (RNA-seq, proteomics) to place UbiB regulation in broader context

  • Data normalization and statistical analysis:

    • Normalize to multiple reference genes verified to be stable under test conditions

    • Apply appropriate statistical tests (ANOVA with post-hoc tests) for multiple conditions

    • Consider biological replicates (minimum n=3) to account for natural variation

  • Interpretation framework:

    • Compare ubiB expression with genes from the O₂-independent pathway (ubiT, ubiU, ubiV)

    • Correlate expression changes with ubiquinone levels measured by HPLC

    • Consider bacterial growth characteristics and metabolic state when interpreting results

    • Evaluate regulatory patterns in the context of known oxygen-responsive regulators (like Fnr)

  • Functional correlation:

    • Connect expression changes to respiratory capacity measurements

    • Assess impacts on bacterial fitness under different conditions

    • Consider ecological relevance of observed expression patterns

This comprehensive approach allows researchers to meaningfully interpret UbiB expression data within the context of bacterial adaptation to varying oxygen environments.

What methods are available for assessing the functional activity of UbiB in ubiquinone biosynthesis?

Multiple complementary approaches can be employed to assess UbiB functional activity:

  • Genetic approaches:

    • Create precise ubiB knockout mutants without polar effects on adjacent genes

    • Perform genetic complementation with wild-type and mutated versions of ubiB

    • Assess restoration of ubiquinone biosynthesis and respiratory function

    • Create conditional mutants to study essential functions

  • Biochemical analysis:

    • Quantify ubiquinone levels via HPLC or LC-MS in wild-type versus mutant strains

    • Identify accumulating intermediates in ubiB mutants to determine specific blocked steps

    • Measure enzyme activities with purified recombinant UbiB using synthetic or natural substrates

    • Employ enzyme kinetics to characterize catalytic parameters

  • Isotope labeling studies:

    • Use ¹⁸O₂ labeling to track oxygen incorporation into ubiquinone and intermediates

    • Apply ¹³C-labeled precursors to follow carbon flux through the pathway

    • Compare labeling patterns between wild-type and ubiB mutant strains

  • Physiological assessments:

    • Measure respiratory capacity through oxygen consumption rates

    • Assess growth characteristics under various respiratory conditions

    • Compare sensitivity to respiratory inhibitors between wild-type and mutant strains

    • Evaluate membrane potential and proton motive force

  • Structural biology approaches:

    • Determine UbiB structure through X-ray crystallography or cryo-EM

    • Identify potential substrate binding sites and catalytic residues

    • Perform site-directed mutagenesis of predicted functional residues

These multifaceted approaches provide comprehensive insights into UbiB function within the ubiquinone biosynthetic pathway.

How do the regulatory mechanisms controlling ubiB expression compare with those of ubiT, ubiU, and ubiV genes?

Understanding the regulatory mechanisms governing ubiquinone biosynthesis pathway genes provides insights into bacterial adaptation strategies:

  • Transcriptional regulation:

    • The ubiT, ubiU, and ubiV genes in E. coli and related bacteria are transcribed as two divergent operons under the control of the O₂-sensing Fnr transcriptional regulator

    • Comparative analysis of the ubiB promoter region should investigate potential Fnr binding sites and other oxygen-responsive elements

    • Transcription factor binding studies (ChIP-seq) can identify regulators acting on ubiB versus ubiTUV genes

  • Oxygen-responsive regulation:

    • The O₂-independent pathway genes show clear anaerobic induction through Fnr

    • UbiB expression patterns across oxygen gradients would provide valuable comparative data

    • Potential cross-regulation between pathways may exist to coordinate ubiquinone biosynthesis

  • Growth phase-dependent regulation:

    • Expression profiles across growth phases may reveal differential temporal regulation

    • Integration with global regulatory networks (stringent response, stationary phase factors)

    • Potential post-transcriptional regulatory mechanisms (small RNAs, riboswitches)

  • Metabolic regulation:

    • Response to electron acceptor availability (nitrate, fumarate, etc.)

    • Feedback inhibition by ubiquinone or pathway intermediates

    • Integration with central metabolism and respiratory state

Understanding these regulatory relationships is crucial for elucidating how bacteria coordinate ubiquinone biosynthesis across varying oxygen conditions, potentially using both pathways depending on environmental circumstances.

What role might UbiB play in Salmonella paratyphi B pathogenesis and host adaptation?

The role of UbiB in Salmonella paratyphi B pathogenesis likely extends beyond basic metabolism:

  • Adaptation to host environments:

    • The gastrointestinal tract presents varying oxygen gradients that require metabolic flexibility

    • UbiB-dependent respiration may be critical in specific host niches with particular oxygen tensions

    • Transition between aerobic and anaerobic environments during infection requires coordinated regulation of respiratory pathways

  • Virulence factor expression:

    • Respiratory state influences expression of virulence factors through global regulators

    • Metabolic fitness affects competitive ability against commensal microbiota

    • Energy production capacity impacts various virulence-associated processes (motility, secretion systems)

  • Immune evasion:

    • Respiratory flexibility may contribute to survival within phagocytes

    • Metabolic adaptation affects resistance to oxidative and nitrosative stress

    • Host immune response includes targeting of bacterial respiration (reactive oxygen species)

  • Antibiotic susceptibility:

    • Respiratory state influences susceptibility to certain antimicrobials

    • Membrane energetics dependent on ubiquinone affects drug uptake and efflux

    • Persister cell formation may involve respiratory adaptations

  • Host-specific adaptations:

    • Serological responses against S. paratyphi can be measured using luminescent-based serum bactericidal assays (L-SBA)

    • Metabolic requirements may differ between acute infection and chronic carriage states

    • Nutritional immunity (host sequestration of essential nutrients) may influence respiratory strategies

These factors highlight the potential significance of UbiB in the pathogenic lifestyle of S. paratyphi B and suggest it may represent a target for therapeutic intervention.

Table 1: Comparison of O₂-dependent and O₂-independent ubiquinone biosynthesis pathways

FeatureO₂-dependent pathway (UbiB)O₂-independent pathway (UbiUVT)
Key proteinsUbiB and othersUbiU, UbiV, UbiT
Oxygen requirementRequires O₂ as substrateFunctions without O₂
CofactorsVarious monooxygenases4Fe-4S clusters in UbiU and UbiV
RegulationNot fully characterized in S. paratyphi BUnder control of O₂-sensing Fnr regulator
Functional significancePrimary pathway under aerobic conditionsEssential for nitrate respiration, uracil biosynthesis under anaerobiosis
Evolutionary distributionWidely distributed in proteobacteriaFound in alpha-, beta-, and gamma-proteobacteria
Contribution to pathogenesisImportant in oxygen-rich host environmentsCritical for adaptation to anaerobic host niches
Hydroxylation mechanismDirect O₂ incorporationAlternative oxygen source (likely water)

Table 2: Methodological approaches for studying UbiB in Salmonella paratyphi B

MethodApplicationTechnical considerationsExpected outcomes
Recombinant protein expressionBiochemical characterizationTris-based buffer with 50% glycerol for storage; avoid freeze-thaw cyclesPure protein (50 μg typical yield) for in vitro studies
PCR-based identificationStrain typing and identificationDesign primers specific to ubiB gene (SPAB_04928)Sensitive and specific identification of S. paratyphi B strains
Gene knockout studiesFunctional characterizationCreate precise deletion without polar effectsPhenotypic effects related to ubiquinone deficiency
RT-qPCRExpression analysisNormalize to stable reference genesQuantitative data on ubiB expression under various conditions
Metabolite profilingPathway analysisLC-MS for detection of ubiquinone and intermediatesIdentification of UbiB-dependent steps in biosynthesis
Isotope labelingReaction mechanism studies¹⁸O₂ labeling and controlled oxygen exposureTrack incorporation of oxygen atoms in ubiquinone
Bacterial respiration assaysFunctional relevanceCompare wild-type and mutant strainsQuantify contribution to respiratory capacity
Infection modelsPathogenesis studiesMouse models, cell culture systemsAssess contribution to virulence and host adaptation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.