Recombinant Salmonella paratyphi B Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Salmonella paratyphi B Prolipoprotein Diacylglyceryl Transferase (Lgt) is a bacterial enzyme critical for lipoprotein biogenesis, a process essential for Gram-negative bacterial growth and pathogenesis. This enzyme catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the cysteine residue of prolipoproteins, forming thioether bonds required for membrane anchoring . Its role in bacterial survival and antibiotic resistance has made it a target for therapeutic intervention .

Protein Structure and Sequence

  • Gene: Encoded by the lgt gene (SPAB_03734 locus) .

  • Amino Acid Sequence: Comprises 291 residues (UniProt ID: A9N2L8) with a molecular mass of ~31.6 kDa .

  • Expression: Recombinant Lgt is produced in Escherichia coli and purified using affinity chromatography .

Table 1: Key Molecular Features of Recombinant Lgt

PropertyDetails
SpeciesSalmonella paratyphi B (strain ATCC BAA-1250/SPB7)
TagDetermined during production
Storage BufferTris-based buffer with 50% glycerol
Sequence Region Expressed1–291 (full-length protein)
Hydropathy ProfileSeven transmembrane domains, N-terminal periplasmic orientation

Catalytic Mechanism

Lgt facilitates the first step in lipoprotein maturation:

  1. Substrate Recognition: Binds phosphatidylglycerol and prolipoprotein via conserved motifs (e.g., Lgt signature motif) .

  2. Diacylglyceryl Transfer: Attaches the sn-1,2-diacylglyceryl group to the cysteine +1 residue of the lipobox (e.g., [LVI][ASTVI][GAS]C) .

  3. Membrane Topology: Seven transmembrane helices position active sites periplasmically, enabling interaction with substrates .

Table 2: Essential Residues for Lgt Activity

ResidueRole in CatalysisConservation Across Species*
Y26Critical for substrate bindingGram-negative and Gram-positive
N146Stabilizes reaction intermediatesUniversal
G154Maintains structural integrity of active siteUniversal
R143/E243Facilitate phosphatidylglycerol interactionPartially conserved

*Based on comparative analysis of E. coli, S. aureus, and S. paratyphi B .

Antibacterial Target Validation

  • Essentiality: Depletion of Lgt in Salmonella leads to outer membrane destabilization, increased antibiotic susceptibility, and cell death .

  • Inhibitor Development: Compound G2824 inhibits Lgt activity in vitro (IC₅₀ = 0.5 µM) and shows bactericidal effects against multidrug-resistant Acinetobacter baumannii and E. coli . Unlike LspA inhibitors, Lgt inhibitors remain effective even in lpp-deletion strains .

Key Findings from Inhibitor Studies:

  • Lgt inhibition prevents diacylglyceryl modification, accumulating unmodified prolipoprotein (UPLP) .

  • Phenotypic effects include outer membrane blebbing and increased cell size, mimicking Lgt-depletion strains .

Experimental Use

  • ELISA and Binding Assays: Recombinant Lgt is used to screen inhibitors and study enzyme-substrate interactions .

  • Structural Studies: Supports crystallography and mutagenesis to map functional domains .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order remarks and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
As a standard practice, all our proteins are shipped with regular blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development accordingly.
Synonyms
lgt; SPAB_03734; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPDFDPVIFSIGPVALHWYGLMYLVGFVFAMWLAVRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPLFLDNPLYLFRVWDGGMSFHGGLIGVILVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPDFRFAMLFPGSRAEDIALLPSH PQWQPIFDTYGVLPRHPSQLYELALEGVVLFIILNLFIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIIAGAIMMVWAYRRRPQQHVS
Uniprot No.

Target Background

Function
Recombinant Salmonella paratyphi B Prolipoprotein diacylglyceryl transferase (lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This reaction represents the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) in Salmonella paratyphi B?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme involved in the biosynthesis of bacterial lipoproteins in Salmonella paratyphi B. It catalyzes a critical step in the lipid modification pathway of bacterial lipoproteins. In Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7), lgt is encoded by the lgt gene (ordered locus name: SPAB_03734) and has been assigned the UniProt accession number A9N2L8 with an enzyme classification number EC 2.4.99.- . The mature protein spans expression region 1-291 and contains specific sequences necessary for its enzymatic function in lipoprotein processing .

What role does lgt play in bacterial physiology and pathogenesis?

Lgt plays a crucial role in bacterial physiology by catalyzing a key step in lipoprotein biosynthesis. Studies with related bacteria reveal that inactivation of lgt leads to significant physiological changes, including increased release of lipoproteins into the extracellular environment . In pathogenic bacteria like Listeria monocytogenes, lgt deletion impairs intracellular growth in different eukaryotic cell lines, suggesting its importance in host-pathogen interactions . For Salmonella paratyphi B specifically, lgt function may be associated with the virulence profile of different strains, particularly those classified as systemic pathovar (SPV) which are associated with systemic infections rather than localized gastroenteritis .

How does lgt activity differ between systemic and enteric Salmonella paratyphi B strains?

Research indicates significant molecular differences between Salmonella paratyphi B strains associated with systemic infections (systemic pathovar, SPV) versus those causing localized enteric infections (enteric pathovar, EPV). While specific lgt activity differences have not been directly characterized in the search results, the pattern of virulence genes including sopB, sopD, sopE1, avrA, and sptP appears to differ between these pathovars . This molecular distinction correlates with clinical outcomes, where SPV strains are associated with paratyphoid fever and systemic spread, while EPV strains typically cause gastroenteritis . The table below illustrates some of the distinguishing characteristics between these strain types:

PathovarClinical Presentationd-Tartrate FermentationCommon Phage TypesTypical Source
SPVSystemic infections, fever, septicemiaNegativeTaunton/B7, 3a1/B6Human carriers, water
EPVGastroenteritisPositive3b var 2, UT/NCFood sources, environment

This distinction suggests potential differences in lipoprotein processing and function that may contribute to pathogenesis differences .

How can experimental design principles be applied to optimize studies of lgt function?

Research on complex bacterial proteins like lgt can benefit significantly from optimal experimental design approaches. When investigating lgt function in Salmonella paratyphi B, researchers should consider:

  • Subset Selection for Big Data Analysis: When dealing with large datasets from genomic or proteomic experiments, optimal experimental design principles can be applied to select subsets of data that maximize information gain. In simulation studies, designed approaches have shown that sample sizes can often be reduced by approximately 50% compared to random sampling while maintaining comparable statistical power .

  • Sequential Optimization Approach: Implement a sequential design approach where initial experimental results inform subsequent experiments. This approach allows for adaptively targeting specific aspects of lgt function based on preliminary findings .

  • Utility Function Selection: Choose appropriate utility functions based on experimental objectives. For parameter estimation of lgt function, utility functions based on Fisher information matrix determinants may be optimal, while for model discrimination, Kullback-Leibler divergence might be more appropriate .

As demonstrated in computational simulations, properly designed experimental approaches can achieve higher information yields with fewer samples compared to random sampling strategies, with observed information from designed subsets consistently outperforming random sampling of equivalent size .

What methodological approaches can verify predicted lipoproteins processed by lgt in Salmonella paratyphi B?

Verification of predicted lipoproteins processed by lgt can be methodically approached using several complementary techniques:

  • lgt Gene Deletion Approach: A powerful method for experimental verification of lipoproteins involves creating a Δlgt mutant strain. When lgt is deleted, lipoproteins that would normally be anchored to the membrane are instead released into the extracellular environment. Comparative proteomic analysis between wild-type and Δlgt mutant strains can systematically identify these released proteins .

  • Extracellular Proteome Analysis: Using techniques like 2D gel electrophoresis or liquid chromatography coupled with mass spectrometry (LC-MS/MS) to analyze the extracellular proteome of wild-type versus Δlgt mutant strains. This approach has successfully identified 26 of 68 predicted lipoproteins in related bacteria .

  • Bioinformatic Prediction Coupled with Experimental Validation: Initial bioinformatic prediction of lipoproteins based on signal sequences and lipid modification motifs, followed by targeted validation using the Δlgt release assay. This combined approach provides a comprehensive identification strategy .

  • PCR and Blot Techniques: These methods can identify the presence, polymorphism, and expression of various lipoprotein genes, helping to distinguish between strains with different pathogenic potential .

This systematic approach not only identifies lipoproteins processed by lgt but also provides insight into their potential roles in bacterial physiology and pathogenesis.

How can lateral gene transfer (LGT) analysis inform our understanding of lgt evolution across bacterial species?

The study of lateral gene transfer (LGT) provides valuable insights into the evolution of genes like lgt across bacterial species and potentially into host genomes:

  • Comparative Genomic Analysis: By examining lgt sequences across diverse bacterial species, researchers can identify potential lateral gene transfer events that have shaped the evolution of this enzyme. The presence of homologous genes with unexpected phylogenetic distributions may indicate horizontal transmission .

  • Sequence Polymorphism Analysis: Detailed analysis of lgt sequence polymorphisms across bacterial species can reveal evolutionary relationships and potential adaptation to different ecological niches or host environments .

  • Integration Site Analysis: If bacterial lgt genes have been transferred to other organisms, analyzing the integration sites and surrounding genetic context can provide insights into the mechanisms and consequences of such transfers .

  • Functional Conservation Assessment: Determining whether the enzymatic function of lgt is conserved across species that have acquired the gene through LGT versus vertical inheritance can reveal selective pressures and functional constraints on this enzyme .

Research suggests that LGT events are particularly common in bacteria-insect interactions, especially with endosymbionts that colonize germ cells. While direct evidence for lgt transfer to mammals is limited, the theoretical possibility exists particularly for somatic cell integration, which could have implications for understanding host-pathogen interactions .

What is the relationship between lgt activity and virulence gene expression patterns in Salmonella paratyphi B?

The relationship between lgt activity and virulence gene expression in Salmonella paratyphi B appears to be complex and potentially strain-dependent:

  • Pathovar-Specific Gene Patterns: Systemic pathovar (SPV) strains of Salmonella paratyphi B show specific patterns of virulence genes including sopB, sopD, sopE1, avrA, and sptP. These patterns may correlate with different lipoprotein profiles processed by lgt .

  • Molecular Typing Correlation: The table below shows the correlation between virulence gene presence and strain classification:

StrainPathovarsopE1 PCRsopE1 RFLP patternsopE1 (I) PCRsopE1 (II) PCR
B309SPV+II-+
00-08652EPV----
00-08652 (ΦSopE309)EPV+II-+
A36 (Typhimurium)-----

This data suggests that specific virulence profiles correlate with the clinical manifestation of disease, with potentially different demands on the lipoprotein processing machinery .

  • Regulatory Networks: While not explicitly detailed in the search results, the activity of lgt likely intersects with regulatory networks controlling virulence gene expression, potentially through processed lipoproteins that function as signaling molecules or structural components of virulence systems.

  • Host-Pathogen Interface: Lipoproteins processed by lgt may serve as pathogen-associated molecular patterns (PAMPs) recognized by host immune systems, influencing the course of infection and the balance between systemic spread and localized infection .

What are the optimal storage and handling conditions for recombinant lgt protein?

Based on empirical data, the following storage and handling protocols are recommended for maintaining recombinant Salmonella paratyphi B lgt protein stability and activity:

  • Storage Temperature: Store the protein at -20°C for routine storage, or at -80°C for extended preservation. This temperature range minimizes protein degradation and maintains enzymatic activity .

  • Buffer Composition: Optimal storage buffer consists of a Tris-based buffer with 50% glycerol, specifically optimized for this protein's stability .

  • Aliquoting Strategy: Prepare working aliquots to be stored at 4°C for up to one week to avoid repeated freeze-thaw cycles. Research indicates that repeated freezing and thawing significantly reduces protein activity .

  • Concentration Considerations: Standard research preparations typically maintain the protein at a concentration allowing for 50 μg per unit, though other quantities can be prepared based on experimental needs .

  • Quality Control Metrics: Regular assessment of protein purity and activity is essential, particularly for proteins used in functional assays or structural studies.

Adhering to these storage and handling guidelines ensures maximum retention of lgt enzymatic activity and structural integrity for experimental applications.

How can researchers design experiments to compare lgt function between different Salmonella pathovars?

Designing robust comparative experiments for lgt function across different Salmonella pathovars requires careful consideration of several methodological aspects:

  • Strain Selection Strategy: Include representative strains from both systemic pathovar (SPV) and enteric pathovar (EPV) groups, ensuring that strains are well-characterized for virulence gene profiles and clinical origin. The table below suggests a sampling design:

Strain CategoryNumber of StrainsSelection CriteriaControl Strains
SPV clinical4-6Different phage types, d-tartrate negativeReference strain B309
EPV clinical4-6Different phage types, d-tartrate positiveReference strain 00-08652
Environmental2-3Water/food isolates-
Other Salmonella2Different species, e.g., S. TyphimuriumStrain A36
  • Experimental Design Optimization: Apply principles of optimal experimental design to maximize information gain while minimizing experimental resources. This approach has been shown to require roughly 50% fewer samples than random sampling approaches while maintaining comparable statistical power .

  • Functional Assays: Implement multiple complementary assays:

    • Lipoprotein processing efficiency using radiolabeled precursors

    • Membrane vs. secreted lipoprotein ratios via fractionation techniques

    • Cellular localization studies using fluorescently tagged lipoproteins

    • Virulence phenotype assessment in cell culture models

  • Genetic Manipulation Approach: Create isogenic Δlgt mutants in representative strains from each pathovar to directly compare the effects of lgt inactivation on lipoprotein processing and virulence phenotypes across different genetic backgrounds .

This multi-faceted experimental design allows for robust comparison of lgt function and its relationship to virulence across different Salmonella paratyphi B pathovars.

What analytical techniques are most effective for characterizing lgt-processed lipoproteins?

A comprehensive approach to characterizing lgt-processed lipoproteins involves multiple complementary analytical techniques:

  • Comparative Proteomics Strategy:

    • 2D gel electrophoresis coupled with mass spectrometry to identify differentially expressed proteins

    • Label-free quantitative proteomics to measure relative abundance changes

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) for precise quantification

    The comparative analysis of wild-type versus Δlgt mutant strains has successfully identified 26 of 68 predicted lipoproteins in related bacteria, demonstrating the power of this approach .

  • Structural Analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • NMR spectroscopy for detailed structural characterization

    • X-ray crystallography for atomic-level resolution of processed lipoproteins

  • Lipid Analysis:

    • Thin-layer chromatography (TLC) to separate and identify lipid modifications

    • Mass spectrometry for precise determination of lipid moieties

    • Gas chromatography for fatty acid composition analysis

  • Functional Assays:

    • Bacterial two-hybrid systems to identify protein-protein interactions

    • Cell culture assays to assess immunostimulatory properties

    • In vitro enzyme assays to measure activity of processed lipoproteins

By combining these analytical approaches, researchers can develop a comprehensive understanding of the structural and functional properties of lipoproteins processed by lgt in Salmonella paratyphi B and their potential roles in bacterial physiology and pathogenesis.

How might lgt-deficient Salmonella paratyphi B strains be utilized in vaccine development?

The potential application of lgt-deficient strains in vaccine development presents an innovative research direction:

  • Attenuated Virulence Profile: Research with other bacterial species has demonstrated that Δlgt mutants show impaired intracellular growth in eukaryotic cells, suggesting attenuated virulence . This property could be leveraged to develop live attenuated vaccines with reduced pathogenicity but maintained immunogenicity.

  • Enhanced Immunogenicity Hypothesis: Deletion of lgt leads to increased release of lipoproteins into the extracellular environment . These released lipoproteins may serve as potent immunogens, potentially enhancing the immunostimulatory properties of the vaccine strain.

  • Customizable Antigen Display: The altered lipoprotein processing in Δlgt strains could be exploited to engineer strains that display or release specific antigens of interest, creating customized vaccine candidates targeting particular immune responses.

  • Differential Diagnostic Potential: The unique profile of released lipoproteins from Δlgt strains could enable serological distinction between vaccinated individuals and those with natural infections, facilitating the development of companion diagnostic tests.

  • Safety Considerations: Extensive characterization of virulence attenuation, genetic stability, and potential reversion would be required before clinical application. The complex relationship between lgt function and the diverse pathovar profiles of Salmonella paratyphi B strains requires careful consideration in vaccine design .

This approach would require thorough preclinical assessment but represents a promising avenue for next-generation typhoid fever vaccine development.

What implications do recent findings on lateral gene transfer have for understanding lgt evolution?

Recent findings on lateral gene transfer (LGT) suggest several important implications for understanding lgt evolution and function:

  • Evolutionary Trajectory Analysis: Lateral gene transfer events may have contributed to the evolution of lgt across bacterial species, potentially explaining functional differences observed between diverse bacterial pathogens . Comparative genomic analysis could reveal how lgt acquisition or modification through LGT has influenced bacterial adaptation to different ecological niches.

  • Host-Pathogen Co-evolution: Research indicates that LGT from bacteria to animals occurs more frequently than previously appreciated, particularly with endosymbionts that colonize germ cells . While evidence for LGT to mammals is limited, theoretical possibilities exist for somatic cell integration, which could influence host-pathogen interactions.

  • Regulatory Network Integration: Laterally transferred genes must integrate into existing regulatory networks to become functional. Understanding how lgt integrates into different regulatory contexts following transfer events could provide insights into bacterial adaptation mechanisms.

  • Functional Diversification: LGT events may have contributed to functional diversification of lgt across bacterial species, potentially explaining observed differences in lipoprotein processing efficiency, substrate specificity, or association with virulence.

  • Taxonomic Distribution Patterns: Analysis of lgt distribution across bacterial taxa, with attention to incongruences with species phylogenies, could identify potential LGT events that have shaped the current distribution and function of this enzyme.

These implications highlight the importance of considering evolutionary history, including potential LGT events, when studying lgt function and developing targeted interventions against bacterial pathogens.

How can experimental design principles improve the efficiency of lgt-related research?

Application of modern experimental design principles can significantly enhance efficiency and information yield in lgt-related research:

  • Optimal Sampling Strategies: Rather than using traditional full factorial designs, researchers can implement optimal experimental design approaches that maximize information gain while minimizing resource expenditure. Simulations demonstrate that properly designed experiments can achieve comparable statistical power with approximately half the sample size of random sampling approaches .

  • Sequential Adaptive Designs: Implementing sequential experimental designs where each phase informs the next allows for adaptive optimization of experimental conditions. This approach is particularly valuable for complex systems like lgt activity where multiple factors may interact in non-linear ways .

  • Design Windows Approach: For experiments where precise control of conditions is challenging, implementing "design windows" or "sampling windows" consisting of ranges of near-optimal designs can provide practical flexibility while maintaining statistical rigor .

  • Computational Optimization: Utilizing computational tools to optimize experimental parameters before wet-lab implementation can save significant resources. Utility functions based on information theory, such as Shannon information gain or Kullback-Leibler divergence, provide quantitative metrics for design optimization .

  • Dimension Reduction Techniques: For high-dimensional data resulting from -omics approaches to studying lgt function, dimension reduction techniques coupled with optimal design can identify the most informative variables and experimental conditions .

The table below quantifies the potential efficiency gains from designed versus random sampling approaches:

Experimental ContextSample Size (Random)Sample Size (Designed)Information Gain Ratio
Uncorrelated covariates200100~2.0x
Positively correlated covariates18090~2.0x
Negatively correlated covariates150100~1.5x

These principles collectively enable more efficient use of research resources while maximizing scientific insights about lgt function and activity .

What are the key knowledge gaps in our understanding of Salmonella paratyphi B lgt?

Despite significant advances, several critical knowledge gaps remain in our understanding of Salmonella paratyphi B lgt:

  • Pathovar-Specific Variations: While molecular differences between systemic and enteric pathovars have been identified , the specific role of lgt in these distinct pathogenic profiles remains incompletely characterized. How lgt activity may differ between these pathovars and contribute to their distinct clinical presentations requires further investigation.

  • Substrate Specificity Determinants: The molecular basis for lgt substrate recognition and the factors determining which lipoproteins are efficiently processed in Salmonella paratyphi B remain poorly defined. This information is critical for understanding the enzyme's role in bacterial physiology and pathogenesis.

  • Regulatory Networks: The integration of lgt activity into broader regulatory networks controlling virulence gene expression in Salmonella paratyphi B is not fully elucidated. Understanding these connections would provide insights into the coordinated bacterial response during infection.

  • Evolutionary History: The potential contribution of lateral gene transfer to lgt evolution across Salmonella species and serovars requires further investigation to understand the enzyme's current functional diversity .

  • Immunomodulatory Effects: The specific immunological consequences of lgt-processed lipoproteins in Salmonella paratyphi B infection, particularly in distinguishing between systemic and enteric disease outcomes, represent a significant knowledge gap with implications for vaccine development.

Addressing these knowledge gaps through targeted research will advance our understanding of this important enzyme and may reveal new approaches for intervention against Salmonella paratyphi B infections.

How might future research directions advance our understanding of lgt in bacterial pathogenesis?

Future research directions that could significantly advance our understanding of lgt in bacterial pathogenesis include:

  • Comparative Functional Genomics: Systematic comparison of lgt function across diverse bacterial pathogens, including different Salmonella pathovars, could reveal evolutionary adaptations and species-specific features of lipoprotein processing machinery .

  • High-Resolution Structural Studies: Determination of the three-dimensional structure of Salmonella paratyphi B lgt through crystallography or cryo-electron microscopy would provide insights into substrate recognition and catalytic mechanism, potentially enabling structure-based inhibitor design.

  • Systems Biology Approaches: Integration of transcriptomic, proteomic, and metabolomic data to place lgt function within the broader context of bacterial physiology and host-pathogen interactions would provide a more comprehensive understanding of its role in pathogenesis.

  • In Vivo Infection Models: Development of animal models that recapitulate the distinct clinical presentations of different Salmonella paratyphi B pathovars would enable investigation of lgt's role in systemic versus enteric disease outcomes under physiologically relevant conditions.

  • Immunological Studies: Detailed characterization of host immune responses to lgt-processed lipoproteins could reveal their role in modulating immunity and potentially explain the different disease outcomes associated with various Salmonella paratyphi B strains.

  • Therapeutic Targeting Strategies: Exploration of lgt as a potential antimicrobial target, including development of specific inhibitors, could lead to novel therapeutic approaches against Salmonella paratyphi B infections, particularly those caused by antibiotic-resistant strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.