Recombinant Salmonella paratyphi B Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; SPAB_02925; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWMLSMRFNPLHQAIPIGTLTANLLGAFIIGMGFAWFNRMTH IDPMWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVLINLLGSFAMTALAFWL FSAAAAR
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration and mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Salmonella paratyphi B Protein CrcB homolog (crcB) and what is its relevance in research?

Recombinant Salmonella paratyphi B Protein CrcB homolog (crcB) is a full-length protein (127 amino acids) derived from Salmonella paratyphi B strain ATCC BAA-1250/SPB7. The protein is expressed recombinantly, typically in E. coli expression systems, to obtain pure protein for research applications.

The CrcB protein is important in research due to its role in bacterial physiology. While the specific function of CrcB in Salmonella paratyphi B is still being elucidated, homologous proteins in other bacteria have been associated with fluoride ion transport, camphor resistance, and potentially pathogenicity factors .

This protein is particularly valuable for researchers studying:

  • Salmonella paratyphi B pathogenesis and virulence mechanisms

  • Bacterial membrane proteins and their functions

  • Development of diagnostic tools for Salmonella detection

  • Vaccine development against paratyphoid fever

What are the optimal storage and handling conditions for this recombinant protein?

For maximum stability and activity of Recombinant Salmonella paratyphi B Protein CrcB homolog, the following storage and handling conditions are recommended:

ConditionRecommendation
Storage BufferTris-based buffer with 50% glycerol, optimized for this protein
Short-term StorageStore at -20°C
Long-term StorageStore at -20°C or -80°C
Working AliquotsStore at 4°C for up to one week
Freeze-Thaw CyclesRepeated freezing and thawing is not recommended

To maintain protein integrity:

  • Aliquot the protein upon receipt to minimize freeze-thaw cycles

  • Thaw aliquots on ice and return unused portions to appropriate storage conditions promptly

  • When diluting, use buffers at physiological pH (7.2-7.4) unless specific assay conditions dictate otherwise

  • Centrifuge protein solutions briefly before opening to ensure all material is at the bottom of the tube .

How does Salmonella paratyphi B differ from other Salmonella serovars, and what is the significance of CrcB in this context?

Salmonella paratyphi B is a notable serovar within the Salmonella enterica species with distinctive characteristics:

CharacteristicDetails
O-Antigen ClassificationGroup B (O:1,4,5,12)
H-AntigenPhase 1: b; Phase 2: 1,2
Major Biotypes- Sensu stricto (d-tartrate negative) - causes paratyphoid fever
- Java variant (d-tartrate positive) - causes gastroenteritis
Distinguishing FeaturesCan be identified by PCR methods targeting specific O and H antigen genes

The CrcB homolog protein may contribute to Salmonella paratyphi B's pathogenicity profile, though its exact role is still being investigated. Research suggests that different Salmonella paratyphi B strains have specific patterns of virulence genes including sopB, sopD, sopE1, avrA, and sptP that may work in concert with membrane proteins like CrcB .

The diversity within this serovar makes proteins like CrcB potentially valuable markers for distinguishing between strains that cause systemic disease versus those causing enteric symptoms .

What methods are most effective for optimizing expression of Recombinant Salmonella paratyphi B Protein CrcB homolog?

Optimizing expression of Recombinant Salmonella paratyphi B Protein CrcB homolog requires attention to several factors:

  • Translation Initiation Site Accessibility:

    • Research shows that accessibility of translation initiation sites is the single best predictor of successful protein expression

    • Using mRNA base-unpairing across Boltzmann's ensemble can accurately predict expression success or failure

    • Tools like TIsigner can be used to modify up to the first nine codons with synonymous substitutions to improve accessibility

  • Expression System Selection:

    • E. coli is the most common host for this protein

    • Consider using strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Expression vectors with moderate-strength promoters may yield better results than strong promoters for membrane proteins

  • Induction Conditions:

    • Lower temperatures (16-25°C) often improve membrane protein folding

    • Reduced inducer concentrations can prevent toxic accumulation

    • Extended expression times at lower temperatures may increase yield of functional protein

  • Media and Growth Conditions:

    • Enriched media (e.g., TB, 2XYT) often improves yield

    • Consider additives like glycerol (0.5-2%) to stabilize membrane proteins

    • Monitor growth curves carefully as overexpression of membrane proteins can be toxic

Studies analyzing 11,430 recombinant protein production experiments found that accessibility of translation initiation sites was significantly more important than codon adaptation index (CAI) or G+C content in predicting successful expression .

What purification strategies are most effective for Recombinant Salmonella paratyphi B Protein CrcB homolog?

Purification of membrane proteins like CrcB homolog requires specialized approaches:

  • Membrane Extraction:

    • Efficient cell lysis using methods that preserve membrane integrity (e.g., French press, sonication)

    • Membrane isolation through differential centrifugation (typically 100,000-200,000 × g)

    • Solubilization using appropriate detergents (e.g., n-dodecyl-β-D-maltoside (DDM), LDAO, or Triton X-100)

  • Affinity Chromatography:

    • His-tagged versions can be purified using Ni-NTA or TALON resins

    • Include detergent in all buffers (typically at concentrations above CMC)

    • Consider using imidazole gradients rather than step elution

    • Low-concentration DTT (1-5 mM) may improve protein stability

  • Purification Refinement:

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Ion exchange chromatography as an additional purification step

    • Consider detergent exchange during purification if initial detergent is not ideal for downstream applications

  • Quality Control:

    • SDS-PAGE with Coomassie staining for purity assessment (aim for >90% purity)

    • Western blotting for confirmation of identity

    • Circular dichroism to verify secondary structure integrity

    • Dynamic light scattering to assess homogeneity

For structural studies, consider reconstitution into nanodiscs or lipid bilayers to maintain native-like membrane environment and protein functionality.

What are the current methods for studying protein-protein interactions involving CrcB homolog?

Several complementary approaches can be used to investigate protein-protein interactions involving CrcB homolog:

  • In Vitro Methods:

    • Pull-down assays using tagged recombinant CrcB as bait

    • Surface plasmon resonance (SPR) for quantitative binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Crosslinking followed by mass spectrometry identification of partners

  • Cell-Based Methods:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Co-immunoprecipitation from native or overexpression systems

    • Proximity labeling approaches (e.g., BioID, APEX)

    • Fluorescence resonance energy transfer (FRET) for intact cell studies

  • Computational Approaches:

    • Protein-protein interaction prediction based on genomic context

    • Co-expression analysis from transcriptomic studies

    • Structural modeling and docking simulations

  • Functional Validation:

    • Mutational analysis of predicted interaction interfaces

    • Competitive inhibition studies with peptides derived from interaction regions

    • Phenotypic rescue experiments in knockout strains

When designing experiments, it's crucial to consider the membrane localization of CrcB homolog, which presents technical challenges for traditional interaction methods. Detergent selection is critical, as improper detergents can disrupt native interactions.

What genomic context insights help understand CrcB homolog function in Salmonella paratyphi B?

Genomic context analysis provides valuable insights into CrcB homolog function:

  • Evolutionary Conservation:

    • CrcB homologs are found across diverse bacterial species

    • Conservation patterns suggest important functional roles

    • Presence in pathogenic and non-pathogenic species indicates core physiological functions

  • Genomic Organization:

    • In Salmonella paratyphi B strain ATCC BAA-1250/SPB7, crcB is encoded in locus SPAB_02925

    • Analysis of neighboring genes may reveal functional relationships or operonic structures

    • Comparative genomics across Salmonella strains shows variability in genomic context

  • Phylogenetic Distribution:

    • Whole-genome sequencing analysis has classified Salmonella paratyphi B into distinct phylogroups (PGs)

    • Invasive sensu stricto isolates group into a single lineage (PG1)

    • Java biotype comprises diverse lineages (PG2-PG10)

    • These groupings may correlate with different functional roles of constituent proteins

  • Horizontal Gene Transfer Assessment:

    • Analysis for signs of horizontal gene transfer or recombination events

    • Evaluation of GC content and codon usage patterns compared to genome average

    • Identification of mobile genetic elements in proximity to crcB

Researchers can leverage this genomic context information to formulate hypotheses about CrcB function and design experiments to test these hypotheses in various Salmonella strains.

How can researchers confirm the functionality of purified Recombinant Salmonella paratyphi B Protein CrcB homolog?

Confirming the functionality of purified CrcB homolog requires specialized assays:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure

    • Thermal shift assays to measure protein stability

    • Size exclusion chromatography to confirm monodispersity

    • Limited proteolysis to test for proper folding

  • Membrane Insertion Verification:

    • Reconstitution into liposomes or nanodiscs

    • Flotation assays to confirm membrane association

    • Proteoliposome freeze-fracture electron microscopy

  • Functional Assays:

    • Ion transport assays if CrcB functions as a transporter:

      • Liposome-based fluorescence assays with ion-sensitive dyes

      • Electrophysiology measurements (patch-clamp, black lipid membranes)

    • Binding assays with predicted ligands or interaction partners

    • Complementation of knockout bacterial strains

  • In Silico Analysis:

    • Molecular dynamics simulations to predict functional residues

    • Comparison with characterized homologs from other species

    • Structure prediction and docking studies

Given homology to characterized CrcB proteins in other organisms, fluoride ion transport activity would be a reasonable initial functional test, using established protocols for measuring ion flux across reconstituted proteoliposomes.

What are the challenges in crystallizing membrane proteins like CrcB homolog and how can they be addressed?

Membrane proteins like CrcB homolog present significant crystallization challenges:

  • Key Challenges:

    • Limited hydrophilic surface area for crystal contacts

    • Detergent micelles can hinder crystal packing

    • Conformational heterogeneity

    • Instability outside native membrane environment

    • Tendency to aggregate

  • Optimization Strategies:

    • Construct Design:

      • Removal of flexible regions

      • Fusion with crystallization chaperones (e.g., T4 lysozyme, BRIL)

      • Surface entropy reduction by mutating flexible surface residues

    • Detergent Screening:

      • Systematic testing of various detergents and detergent mixtures

      • Detergent exchange during purification

      • Use of facial amphiphiles or novel solubilizing agents

    • Crystallization Approaches:

      • Lipidic cubic phase (LCP) crystallization

      • Bicelle crystallization

      • Antibody fragment co-crystallization to increase hydrophilic surface area

      • Nanobody co-crystallization

    • Crystal Growth Optimization:

      • Microseeding techniques

      • Controlled dehydration

      • Additive screening (e.g., lipids, small molecules)

  • Alternative Structural Methods:

    • Cryo-electron microscopy (increasingly feasible for smaller membrane proteins)

    • Nuclear magnetic resonance (NMR) for dynamic studies

    • X-ray free electron laser (XFEL) for microcrystals

Researchers should be prepared for an iterative optimization process and consider alternative structural biology approaches if crystallization proves particularly challenging.

How can Recombinant Salmonella paratyphi B Protein CrcB homolog be used in vaccine development research?

Recombinant CrcB homolog could contribute to vaccine development against Salmonella paratyphi B through several approaches:

  • Subunit Vaccine Development:

    • CrcB as a potential antigen component in multi-epitope vaccines

    • Assessment of immunogenicity in animal models

    • Evaluation of protective immunity against challenge

    • Combination with other Salmonella antigens for broader protection

  • Reverse Vaccinology Applications:

    • In silico epitope prediction from CrcB sequence

    • B-cell and T-cell epitope mapping

    • Population coverage analysis of predicted epitopes

    • Rational design of epitope-focused immunogens

  • Bacterial Ghost Platform Approach:

    • CrcB-enriched bacterial ghosts as vaccine candidates

    • Research shows bacterial ghost cell-based vaccines can be effective against Salmonella

    • A similar approach using Salmonella Typhi and Paratyphi A showed promising results in mouse models

  • Diagnostic Development:

    • Use as a reference standard in diagnostic assays

    • Development of antibodies against CrcB for diagnostic purposes

    • PCR target development for detecting specific Salmonella paratyphi B strains

When designing such studies, researchers should note that Salmonella paratyphi B sensu stricto causes systemic disease (paratyphoid fever) while the Java variant typically causes gastroenteritis, which may necessitate different vaccine approaches .

What bioinformatic tools are most useful for analyzing CrcB homolog structure and function?

Several bioinformatic tools and approaches are particularly valuable for CrcB homolog analysis:

  • Sequence Analysis Tools:

    • TMHMM/HMMTOP: Prediction of transmembrane regions

    • SignalP: Signal peptide prediction

    • Clustal Omega/MUSCLE: Multiple sequence alignment with homologs

    • ConSurf: Evolutionary conservation mapping

    • I-TASSER/Phyre2/AlphaFold2: Protein structure prediction

  • Functional Prediction Tools:

    • InterProScan: Functional domain identification

    • CELLO/PSORTb: Subcellular localization prediction

    • STRING: Protein-protein interaction network analysis

    • KEGG/BioCyc: Metabolic pathway analysis

    • ProtFun: General function prediction

  • Comparative Genomics Resources:

    • OrthoMCL/OMA: Ortholog identification across species

    • SyntTax: Synteny analysis to identify conserved gene neighborhoods

    • Genome Browsers: Visualization of genomic context

    • PATRIC: Specialized bacterial genomics resource

  • Structural Analysis Tools:

    • PyMOL/UCSF Chimera: Structure visualization and analysis

    • COCOMAPS/PDBePISA: Interface analysis for protein complexes

    • CASTp/POCASA: Pocket and cavity detection

    • MD simulation software: Dynamic behavior analysis

When applying these tools to CrcB homolog, researchers should leverage information from characterized homologs in other bacterial species, which could provide valuable functional insights.

How does the homology between Salmonella paratyphi B CrcB and homologs from other species inform research approaches?

Comparative analysis of CrcB homologs across species provides valuable research direction:

  • Functional Conservation Assessment:

    • CrcB homologs exist across diverse bacterial species

    • In many bacteria, CrcB functions as a fluoride ion channel/transporter

    • Some homologs are associated with camphor resistance (as seen in )

    • Mycobacterium tuberculosis contains a CrcB homolog (Rv3069) that is co-regulated with carbohydrate metabolic processes

  • Structure-Function Relationships:

    • Conserved residues likely indicate functional importance

    • Variable regions may represent species-specific adaptations

    • Transmembrane topology appears consistent across homologs

    • Known functional mechanisms in other species can guide experimental design

  • Experimental Approach Guidance:

    • Cross-species complementation: Testing if Salmonella CrcB can complement defects in other bacterial species

    • Chimeric protein analysis: Swapping domains between homologs to map functional regions

    • Mutation targeting: Focusing on highly conserved residues for site-directed mutagenesis

    • Drug development: Using conserved binding sites as targets for broad-spectrum therapeutics

  • Comparative Analysis Data:

SpeciesProtein NameIdentity to S. paratyphi B CrcBKnown/Predicted Function
S. dublinCrcB homologHigh (>95%)Unknown, likely similar to S. paratyphi B
M. tuberculosisRv3069 (CrcB homolog 1)Moderate (~40-60%)Associated with carbohydrate metabolism
E. coliCrcBHigh (~80-90%)Fluoride ion channel

This comparative approach allows researchers to leverage findings across multiple bacterial species, accelerating understanding of CrcB function in Salmonella paratyphi B.

What advanced microscopy techniques are most suitable for studying CrcB homolog localization and dynamics?

Advanced microscopy techniques offer powerful approaches for studying CrcB homolog:

  • Super-resolution Techniques:

    • STORM/PALM: Single-molecule localization microscopy for precise localization (20-30 nm resolution)

    • STED: Stimulated emission depletion microscopy for live-cell imaging beyond diffraction limit

    • SIM: Structured illumination microscopy for improved resolution with less phototoxicity

    • Application: Map CrcB distribution in bacterial membranes at nanoscale resolution

  • Live-cell Imaging Approaches:

    • FRAP: Fluorescence recovery after photobleaching to measure protein mobility

    • SPT: Single-particle tracking for studying diffusion dynamics of individual molecules

    • FLIM: Fluorescence lifetime imaging to detect protein-protein interactions

    • Application: Measure CrcB mobility and interactions in living bacterial cells

  • Correlative Techniques:

    • CLEM: Correlative light and electron microscopy to combine fluorescence with ultrastructural detail

    • FIB-SEM: Focused ion beam scanning electron microscopy for 3D visualization

    • Cryo-electron tomography: 3D imaging of frozen-hydrated cells at molecular resolution

    • Application: Visualize CrcB in the context of membrane ultrastructure

  • Sample Preparation Considerations:

    • Fusion constructs must preserve protein function

    • Fluorescent protein tags may affect membrane protein topology

    • Consider split-GFP or HaloTag/SNAP-tag systems for minimal disruption

    • Site-specific labeling using unnatural amino acids provides alternative to large tags

For optimal results, validation with complementary techniques is essential, as each method has specific limitations and artifacts when applied to membrane proteins in bacterial systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.