Recombinant Salmonella paratyphi B Putative epimerase lsrE (lsrE)

Shipped with Ice Packs
In Stock

Description

General Information

  • Product Name: Recombinant Salmonella paratyphi B Putative epimerase lsrE (lsrE) .

  • Product Code: CSB-CF430455STF .

  • Storage: It is recommended to store it at -20°C, but for extended storage, it should be conserved at -20°C or -80°C . Repeated freezing and thawing is not recommended; working aliquots should be stored at 4°C for up to one week .

  • UniProt No.: A9MZG7 .

  • Product Type: Transmembrane Protein .

  • Immunogen Species: Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) .

  • Sequence: The sequence of the protein is MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCPQFTVGPWAVGQLPQTFIKDVHLMVADQWTAAQACVKAGAHCITLQAEGDIHLHHTLSWLGQQTVPVIGGEMPVIRGISLCPATPLDVIIPILSDVEVIQLLAVNPGYGSKMRSSDLHERVAQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLVENTRSWRAMFKVAGDTTFLPSTA .

  • Source: in vitro E.coli expression system .

  • Target Names: lsrE .

  • Protein Names: Recommended name: Putative epimerase lsrE EC= 5.1.3.- .

  • Expression Region: 1-254 .

  • Tag Info: N-terminal 10xHis-tagged .

  • Protein Length: Full length protein .

  • Shelf Life: The shelf life is related to many factors, including storage state, buffer ingredients, storage temperature, and the stability of the protein itself . Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, and the shelf life of lyophilized form is 12 months at -20°C/-80°C .

Function and Role

The lsrE gene encodes a putative epimerase, an enzyme that catalyzes the inversion of stereochemical centers in a molecule . While the precise function of LsrE in Salmonella paratyphi B is not fully understood, epimerases play crucial roles in various metabolic pathways, including carbohydrate metabolism and cell wall biosynthesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lsrE; SPAB_05054; Putative epimerase LsrE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
lsrE
Target Protein Sequence
MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCP QFTVGPWAVGQLPQTFIKDVHLMVADQWTAAQACVKAGAHCITLQAEGDIHLHHTLSWLG QQTVPVIGGEMPVIRGISLCPATPLDVIIPILSDVEVIQLLAVNPGYGSKMRSSDLHERV AQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLVENTRSWRAM FKVAGDTTFLPSTA
Uniprot No.

Target Background

Database Links
Protein Families
Ribulose-phosphate 3-epimerase family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What are the predicted structural features of lsrE protein?

The lsrE protein is classified as a putative epimerase, which suggests it belongs to the isomerase class of enzymes that catalyze structural rearrangements within molecules. Based on its sequence characteristics, it is identified as a transmembrane protein . The protein contains regions that suggest a standard epimerase fold, which typically consists of a NAD(P)-binding Rossmann fold domain. While detailed crystallographic studies specific to lsrE are not present in the provided data, related epimerases generally contain an active site with catalytic residues positioned to facilitate the stereochemical inversion of hydroxyl groups in their substrates .

How is recombinant lsrE protein produced and what expression systems are recommended?

Recombinant lsrE protein is typically produced using an in vitro E. coli expression system . The full-length protein (amino acids 1-254) is expressed with an N-terminal histidine tag (10xHis), which facilitates purification through affinity chromatography . For optimal expression, researchers should consider the following methodology:

  • Clone the lsrE gene (SPAB_05054) into an appropriate expression vector containing a strong promoter (e.g., T7) and the histidine tag sequence.

  • Transform the construct into an E. coli expression strain optimized for recombinant protein production (e.g., BL21(DE3)).

  • Induce protein expression using IPTG or appropriate induction methods.

  • Lyse cells and purify the protein using nickel affinity chromatography.

  • Verify protein purity via SDS-PAGE and western blotting.

The expression of transmembrane proteins can be challenging, so optimization of induction temperature, time, and concentration may be necessary to maximize soluble protein yield .

What are the optimal storage conditions for maintaining lsrE protein stability?

To maintain optimal stability of recombinant lsrE protein, implement the following evidence-based storage protocol:

For short-term storage (up to one week): Store working aliquots at 4°C .

For long-term storage:

  • Store at -20°C for standard preservation

  • For extended storage stability, maintain at -80°C

  • The protein is available in both liquid and lyophilized forms, with the latter providing greater stability

The shelf life varies depending on the formulation:

  • Liquid form: approximately 6 months when stored at -20°C/-80°C

  • Lyophilized form: up to 12 months when stored at -20°C/-80°C

Importantly, repeated freeze-thaw cycles significantly reduce protein activity and stability. To prevent degradation, divide the protein into single-use aliquots immediately upon receipt . The storage buffer typically consists of a Tris-based buffer with 50% glycerol, optimized specifically for lsrE protein stability .

What methodological considerations should researchers take when designing experiments with recombinant lsrE?

When designing experiments with recombinant lsrE, researchers should consider several methodological aspects to ensure reliable and reproducible results:

  • Protein Reconstitution Protocol: If using lyophilized protein, reconstitute in an appropriate buffer that maintains protein stability and activity. The specific buffer composition should be optimized for the intended experimental conditions.

  • Activity Assays: As an epimerase (EC 5.1.3.-), design enzyme activity assays that can detect stereochemical inversions in potential substrates. Consider using coupled enzymatic assays or analytical methods such as HPLC or NMR to measure substrate conversion.

  • Buffer Compatibility: Verify that experimental buffers are compatible with the storage buffer (Tris-based with 50% glycerol) . High glycerol concentrations may affect certain assays, requiring dilution or buffer exchange.

  • Temperature Sensitivity: Conduct preliminary experiments to determine the optimal temperature range for protein activity. While storage requires low temperatures, the optimal temperature for enzymatic activity might differ significantly.

  • Co-factors Requirements: Many epimerases require NAD+ or NADP+ as cofactors. Include appropriate cofactors in your reaction mixtures and control for their potential effects on experimental outcomes.

  • Control Experiments: Always include appropriate negative controls (heat-inactivated enzyme) and positive controls (well-characterized epimerase reactions) to validate experimental results .

These considerations should be tailored to specific experimental objectives while maintaining conditions that preserve protein integrity and activity.

How can researchers effectively investigate the enzymatic function of lsrE protein?

To effectively investigate the enzymatic function of lsrE protein, researchers should implement a multi-faceted approach combining biochemical, structural, and computational methods:

  • Substrate Screening Analysis: As a putative epimerase (EC 5.1.3.-), lsrE likely catalyzes stereochemical inversions in specific carbohydrates or related compounds. Employ systematic screening of potential substrates including monosaccharides, disaccharides, sugar phosphates, and sugar alcohols. Monitor reactions using techniques such as thin-layer chromatography, HPLC, or mass spectrometry to detect substrate conversion.

  • Enzyme Kinetics Determination: Once potential substrates are identified, determine kinetic parameters (Km, Vmax, kcat) under varying conditions of pH, temperature, and cofactor concentrations. This provides insights into catalytic efficiency and specificity.

  • Structural Analysis Approaches:

    • Employ circular dichroism (CD) spectroscopy to assess secondary structure elements

    • Consider X-ray crystallography or cryo-EM to determine three-dimensional structure, particularly in complex with substrates or substrate analogs

    • Use site-directed mutagenesis to identify catalytic residues based on sequence alignments with characterized epimerases

  • In Silico Analysis: Utilize homology modeling and molecular docking to predict substrate binding and catalytic mechanisms, generating testable hypotheses about protein function .

  • Metabolic Context Investigation: Examine the genomic context of the lsrE gene (SPAB_05054) in Salmonella paratyphi B to identify potential metabolic pathways involving this enzyme. This might provide clues to physiological substrates and biological roles .

  • Functional Complementation: Consider expressing lsrE in appropriate knockout strains to determine if it can restore specific phenotypes related to bacterial metabolism or virulence.

These approaches, used in combination, provide a comprehensive methodology for elucidating the enzymatic function of this putative epimerase.

What is the potential role of lsrE in Salmonella pathogenicity and virulence mechanisms?

The potential role of lsrE in Salmonella pathogenicity requires examination within the broader context of Salmonella paratyphi B virulence mechanisms. While the search results don't directly establish lsrE's role in virulence, analysis of its properties and genomic context suggests several potential connections:

Salmonella paratyphi B exhibits significant pathogenic diversity, causing diseases ranging from self-limiting gastroenteritis to serious systemic infections (paratyphoid fever) . This pathogenic flexibility is associated with specific genetic determinants and molecular properties that vary between different strains or pathovars.

The lsrE gene (SPAB_05054) may function within pathways relevant to virulence through several potential mechanisms:

  • Quorum Sensing Connection: The "lsr" designation often relates to LuxS-regulated genes involved in quorum sensing, which regulates virulence in many pathogens. If lsrE participates in processing quorum sensing signals, it could influence virulence gene expression.

  • Carbohydrate Metabolism: As a putative epimerase, lsrE likely functions in carbohydrate metabolism, which is crucial for pathogen adaptation to host environments. Metabolic adaptability is a key determinant of virulence in Salmonella species.

  • Pathovar Differentiation: Salmonella paratyphi B strains are differentiated into systemic pathovar (SPV) and enteric pathovar (EPV) based on virulence gene profiles such as sopE1 and avrA . The functional relationship between lsrE and these established virulence factors remains to be elucidated.

Research methodologies to investigate lsrE's role in virulence should include:

  • Gene knockout studies examining virulence phenotypes in infection models

  • Transcriptomic analysis comparing lsrE expression between invasive and non-invasive strains

  • Proteomic studies to identify interaction partners within virulence-associated pathways

How can researchers differentiate between the functional roles of lsrE in different Salmonella paratyphi B pathovars?

Differentiating the functional roles of lsrE between Salmonella paratyphi B pathovars requires sophisticated comparative approaches that account for the established distinctions between systemic pathovar (SPV) and enteric pathovar (EPV) strains. Based on the provided research materials, the following methodological framework is recommended:

  • Comparative Genomic Analysis: Sequence and compare the lsrE gene and its promoter regions across multiple SPV and EPV strains to identify pathovar-specific polymorphisms or regulatory elements. Research has already established distinct genetic signatures between these pathovars, including differential presence of virulence genes like sopE1 and avrA .

  • Transcriptional Profiling: Quantify lsrE expression levels under various conditions (different growth phases, host-mimicking environments) in both pathovars using qRT-PCR or RNA-seq. This may reveal pathovar-specific expression patterns correlating with virulence phenotypes.

  • Protein Function Characterization: Compare the enzymatic properties (substrate specificity, kinetic parameters) of lsrE proteins isolated from representative SPV and EPV strains. Even minor amino acid differences could alter function in ways relevant to pathogenicity.

  • Complementation Studies:

    • Generate lsrE knockout mutants in both pathovars

    • Perform cross-complementation experiments (expressing SPV lsrE in EPV knockout strains and vice versa)

    • Assess the impact on phenotypes related to metabolism and virulence

  • Host-Pathogen Interaction Models: Compare the behavior of wild-type and lsrE mutant strains from both pathovars in cellular infection models (epithelial cells, macrophages) and assess invasion, intracellular survival, and cytokine induction.

This comprehensive approach would establish whether lsrE contributes to the distinct disease manifestations associated with different S. paratyphi B pathovars, potentially revealing new diagnostic or therapeutic targets.

What are the most effective experimental design strategies for studying protein-protein interactions involving lsrE?

Investigating protein-protein interactions (PPIs) involving lsrE requires a strategic combination of complementary methodologies. For optimal experimental design, researchers should implement the following approach:

  • In Silico Prediction of Interaction Partners:

    • Begin with computational prediction of potential interaction partners based on genomic context analysis, focusing on genes co-localized with lsrE (SPAB_05054)

    • Employ homology-based inference using known interaction networks of related epimerases

    • Consider the broader context of Salmonella virulence and metabolism when identifying candidate partners

  • Affinity-Based Methods:

    • Utilize His-tagged recombinant lsrE (as described in the product specifications) for pull-down assays with Salmonella lysates

    • Implement co-immunoprecipitation (Co-IP) with antibodies against lsrE or epitope-tagged versions

    • Consider crosslinking approaches to capture transient interactions

  • Library-Based Screening:

    • Employ bacterial two-hybrid systems, which are well-suited for transmembrane proteins like lsrE

    • Screen against genomic libraries derived from Salmonella paratyphi B to identify physiologically relevant partners

  • Direct Biophysical Characterization:

    • For validated interactions, quantify binding parameters using surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC)

    • Employ hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

  • Functional Validation:

    • Confirm biological relevance by testing mutants defective in the interaction

    • Assess whether disrupting specific interactions affects epimerase activity or related phenotypes

    • Investigate co-expression patterns during infection or under stress conditions

  • Structural Studies:

    • For high-confidence interactions, pursue co-crystallization or cryo-EM studies of lsrE with partner proteins

    • Map interaction domains through systematic truncation analysis

This multi-layered strategy provides redundancy and increases confidence in identified interactions, while accounting for the technical challenges associated with studying transmembrane bacterial proteins like lsrE.

How can researchers integrate lsrE studies with broader investigations of Salmonella paratyphi B pathogenicity mechanisms?

Integrating lsrE studies with broader investigations of Salmonella paratyphi B pathogenicity requires a systems biology approach that contextualizes this putative epimerase within established virulence mechanisms. Based on the research literature, the following methodological framework is recommended:

  • Contextualize lsrE Within Known Virulence Networks:

    • Compare the genomic location of lsrE (SPAB_05054) relative to established pathogenicity islands (SPIs) and virulence genes in S. paratyphi B

    • Analyze potential relationships with the Type Three Secretion System (TTSS) effector proteins that are critical for Salmonella virulence

    • Determine if lsrE expression correlates with known virulence factors such as sopE1, avrA, and SopB that differentiate between systemic and enteric pathovars

  • Implement Multi-Omics Integration:

    • Perform transcriptomic studies comparing lsrE expression patterns with global virulence gene expression under infection-relevant conditions

    • Utilize proteomics to identify changes in the virulence proteome when lsrE is deleted or overexpressed

    • Apply metabolomics to determine if lsrE enzymatic activity impacts metabolites associated with virulence

  • Develop Comprehensive Phenotypic Profiling:

    Phenotypic AssayMethodologyRelevance to Pathogenicity
    Invasion assaysGentamicin protection assay with epithelial cellsAssesses contribution to initial host cell invasion
    Intracellular survivalMacrophage infection studiesEvaluates role in persistent infection
    Biofilm formationCrystal violet staining, confocal microscopyConnects to environmental persistence
    Animal infection modelsMurine typhoid model, streptomycin-pretreated mouse modelDetermines contribution to systemic vs. enteric disease
  • Apply Comparative Approaches Across Pathovars:

    • Examine lsrE sequence, expression, and function in both invasive (d-Ta-) and gastroenteritis-associated (d-Ta+) strains

    • Determine if lsrE contributes to the Jekyll and Hyde characteristics observed in S. paratyphi B lineages

    • Investigate potential links to the phylogenetic groups (PGs) that exhibit different virulence potentials

  • Explore Diagnostic Applications:

    • Assess whether lsrE characteristics could serve as biomarkers for distinguishing between different pathogenic lineages

    • Develop PCR-based or serological approaches targeting lsrE or its products as potential diagnostic tools

This integrated approach connects molecular mechanisms to clinically relevant phenotypes while positioning lsrE research within the broader context of Salmonella pathogenicity.

What are the most challenging technical aspects of working with recombinant lsrE protein and how can they be addressed?

Working with recombinant lsrE protein presents several technical challenges that require specific methodological solutions. Based on its characteristics as a transmembrane putative epimerase, researchers should anticipate and address the following challenges:

  • Solubility and Aggregation Issues:

    • Challenge: As a transmembrane protein, lsrE may have hydrophobic regions prone to aggregation during recombinant expression .

    • Solution:

      • Express protein at lower temperatures (16-20°C) to slow folding and reduce inclusion body formation

      • Evaluate multiple E. coli expression strains (BL21, Rosetta, C41/C43) specifically designed for membrane proteins

      • Include appropriate detergents or solubilizing agents in purification buffers

      • Consider fusion partners that enhance solubility (e.g., MBP, SUMO) in addition to the His-tag

  • Protein Purity and Homogeneity:

    • Challenge: Achieving consistent purity and homogeneity across batches.

    • Solution:

      • Implement multi-step purification combining IMAC (using the N-terminal His-tag) with size exclusion chromatography

      • Validate purity by multiple methods including SDS-PAGE, western blotting, and mass spectrometry

      • Assess homogeneity through dynamic light scattering

  • Activity Preservation:

    • Challenge: Maintaining enzymatic activity during purification and storage.

    • Solution:

      • Carefully optimize buffer conditions (pH, ionic strength, glycerol percentage)

      • Add stabilizing agents such as reducing agents to prevent oxidation of critical cysteines

      • Store in multiple small aliquots to avoid repeated freeze-thaw cycles

      • Validate activity regularly using appropriate enzymatic assays

  • Substrate Identification:

    • Challenge: Identifying the physiological substrate(s) for this putative epimerase.

    • Solution:

      • Screen diverse carbohydrate substrates systematically

      • Consider non-conventional approaches like activity-based protein profiling

      • Utilize metabolomic approaches comparing wild-type and lsrE-deficient Salmonella strains

  • Structural Characterization:

    • Challenge: Obtaining structural information, particularly challenging for transmembrane proteins.

    • Solution:

      • Begin with secondary structure analysis using circular dichroism

      • Consider detergent screening for optimal membrane protein extraction

      • Explore nanodiscs or amphipols as alternatives to detergents for maintaining native-like environment

      • Attempt crystallization in lipidic cubic phases if X-ray crystallography is pursued

These methodological solutions address the specific challenges associated with recombinant lsrE while maintaining scientific rigor and experimental reproducibility.

How does lsrE compare structurally and functionally across different Salmonella species and strains?

Comparing lsrE across different Salmonella species and strains requires a systematic evolutionary analysis framework. Although comprehensive comparative data specific to lsrE is limited in the provided research materials, the following methodological approach leverages what is known about Salmonella paratyphi B diversity to guide comparative studies:

  • Sequence Conservation Analysis:

    • Perform multiple sequence alignments of lsrE homologs across Salmonella species, particularly comparing sequences between:

      • Different S. paratyphi B pathovars (systemic vs. enteric)

      • Other typhoidal Salmonella species (S. Typhi, S. Paratyphi A)

      • Non-typhoidal Salmonella species (S. Typhimurium)

    • Identify highly conserved residues likely crucial for function versus variable regions that might confer strain-specific properties

  • Phylogenetic Positioning:

    • Construct phylogenetic trees of lsrE sequences to determine if its evolution parallels the established phylogenetic groups (PGs) identified within S. paratyphi B

    • Determine if lsrE sequence variations correlate with the Jekyll and Hyde characteristics observed in different lineages

    • Examine whether lsrE evolution aligns with other virulence determinants that distinguish invasive from gastroenteritis-causing strains

  • Functional Conservation Assessment:

    • Express and purify recombinant lsrE proteins from representative strains across the Salmonella phylogeny

    • Compare enzymatic parameters (substrate specificity, kinetics) to identify functional divergence

    • Perform complementation studies across species boundaries to test functional interchangeability

  • Structural Prediction Comparison:

    • Generate homology models of lsrE from different strains based on crystal structures of related epimerases

    • Analyze predicted structural differences, particularly in substrate binding pockets and catalytic sites

    • Correlate structural variations with functional differences and evolutionary relationships

  • Genomic Context Analysis:

    • Compare the genomic neighborhood of lsrE across different Salmonella species

    • Identify conserved gene clusters versus strain-specific arrangements

    • Determine if lsrE is consistently associated with particular pathogenicity islands or regulatory networks across the genus

This comparative approach provides insights into how lsrE has evolved within the context of Salmonella diversification and potentially contributed to the emergence of different pathogenic strategies.

What experimental approaches can researchers use to investigate the potential role of lsrE in host-pathogen interactions?

Investigating the role of lsrE in host-pathogen interactions requires multi-layered experimental approaches that connect molecular mechanisms to cellular and organismal outcomes. Based on the understanding of Salmonella paratyphi B pathogenicity from the provided research materials, the following methodological framework is recommended:

  • Genetic Manipulation Strategies:

    • Generate clean deletion mutants of lsrE in both systemic pathovar (SPV) and enteric pathovar (EPV) strains

    • Create complemented strains expressing lsrE under native and inducible promoters

    • Develop reporter fusions (lsrE-GFP) to monitor expression dynamics during infection

  • Cellular Infection Models:

    Cell TypeExperimental ApproachHost Response Parameters
    Intestinal epithelial cellsPolarized monolayer invasion assaysBacterial adhesion, invasion efficiency, tight junction integrity
    MacrophagesGentamicin protection assaysIntracellular survival, phagosome maturation, inflammasome activation
    Dendritic cellsCo-culture experimentsAntigen presentation, cytokine profiles, T-cell activation
  • Ex Vivo Tissue Models:

    • Employ intestinal organoids to assess the role of lsrE in epithelial interaction in a physiologically relevant 3D environment

    • Test wild-type and ΔlsrE strains in precision-cut liver slices to evaluate hepatic colonization capabilities

  • Host Response Analysis:

    • Characterize immunological signatures induced by wild-type versus ΔlsrE strains

    • Measure cytokine/chemokine profiles using multiplex assays

    • Assess pathogen-associated molecular pattern (PAMP) recognition and downstream signaling

  • In Vivo Infection Studies:

    • Compare colonization, dissemination, and persistence of wild-type and ΔlsrE strains in appropriate animal models

    • Consider both systemic (typhoid-like) and intestinal (gastroenteritis) models to reflect the dual pathogenicity of S. paratyphi B

    • Use competitive index assays (co-infection with wild-type) to detect subtle virulence defects

  • Transcriptional Profiling:

    • Perform dual RNA-seq to simultaneously capture host and pathogen transcriptomes during infection

    • Compare transcriptional responses to wild-type and ΔlsrE strains to identify lsrE-dependent alterations in host-pathogen dialogue

  • Metabolic Interaction Studies:

    • As a putative epimerase, investigate whether lsrE-catalyzed reactions influence host metabolic pathways during infection

    • Perform targeted metabolomics focusing on carbohydrate metabolism in infected versus uninfected cells

This comprehensive experimental framework integrates molecular, cellular, and organismal approaches to elucidate the potential contribution of lsrE to the complex host-pathogen interactions characteristic of Salmonella paratyphi B infections.

What is the recommended protocol for analyzing enzymatic activity of purified recombinant lsrE?

Comprehensive Protocol for lsrE Enzymatic Activity Analysis

The following protocol provides a detailed methodology for analyzing the enzymatic activity of purified recombinant lsrE, integrating information from multiple sources to address the putative epimerase function of this protein:

Materials Required:

  • Purified recombinant lsrE protein (stored according to recommended conditions)

  • Potential substrates: various carbohydrates, focusing on hexoses and pentoses (glucose, galactose, mannose, xylose, etc.)

  • NAD+ and NADP+ (common cofactors for epimerases)

  • Buffer systems spanning pH 5.0-9.0 (typically HEPES, Tris, phosphate buffers)

  • Temperature-controlled spectrophotometer

  • HPLC system with appropriate carbohydrate analysis column

  • NMR spectrometer (for detailed structural confirmation)

Procedure:

  • Initial Screening for Activity (Days 1-2)

    • Prepare reaction mixtures containing:

      • 50 mM buffer (start with pH 7.5)

      • 0.5-2 μg purified lsrE

      • 1-5 mM potential substrate

      • 0.5-1 mM NAD+ or NADP+

    • Incubate at 30°C and 37°C (in separate reactions)

    • At various time points (0, 15, 30, 60 min), remove aliquots and quench reactions

    • Analyze by TLC or HPLC to detect substrate modification

  • Optimization of Reaction Conditions (Days 3-4)

    • For substrates showing activity, determine optimal:

      • pH profile (test range from pH 5.0-9.0)

      • Temperature dependence (25-45°C)

      • Cofactor requirements (NAD+ vs. NADP+, concentration effects)

      • Metal ion dependencies (test with/without Mg2+, Mn2+, Ca2+)

  • Detailed Kinetic Analysis (Days 5-7)

    • Using optimized conditions, perform kinetic analyses:

      • Vary substrate concentration (0.1-10 × Km)

      • Measure initial reaction rates

      • Generate Michaelis-Menten plots to determine:

        • Km (substrate affinity)

        • Vmax (maximum reaction velocity)

        • kcat (turnover number)

        • kcat/Km (catalytic efficiency)

  • Product Characterization (Days 8-10)

    • Confirm epimerase activity through detailed product analysis:

      • Isolate reaction products by HPLC

      • Perform NMR analysis to confirm stereochemical inversion

      • Compare with authentic standards of predicted products

      • Consider mass spectrometry for additional verification

  • Inhibition Studies (Days 11-12)

    • Test potential inhibitors:

      • Substrate analogs

      • Known epimerase inhibitors

      • Determine inhibition constants (Ki) and mechanisms (competitive, non-competitive)

  • Data Analysis and Interpretation

    • Compare kinetic parameters with related epimerases

    • Correlate enzymatic properties with predicted structural features

    • Consider physiological relevance based on determined substrates and reaction conditions

Controls and Validation:

  • Include enzyme-free reactions to account for non-enzymatic conversions

  • Use heat-inactivated enzyme as negative control

  • Include well-characterized epimerases as positive controls

  • Perform replicate experiments (n=3 minimum) for statistical validation

This comprehensive protocol provides a systematic approach to characterizing the enzymatic activity of recombinant lsrE, accounting for its classification as a putative epimerase (EC 5.1.3.-) and incorporating appropriate controls for rigorous biochemical characterization .

What are the most promising directions for future research on lsrE and its role in Salmonella biology?

The current understanding of lsrE presents several promising avenues for future research that could significantly advance our knowledge of Salmonella paratyphi B biology and pathogenesis. Based on the available information, the following directions appear most valuable for continued investigation:

  • Definitive Enzymatic Characterization:

    • Comprehensive substrate screening to definitively identify the natural substrate(s) of this putative epimerase

    • Structural determination through X-ray crystallography or cryo-EM, particularly in complex with substrates

    • Integration of enzymatic function with metabolic pathways specific to Salmonella paratyphi B

  • Pathogenicity Mechanism Exploration:

    • Investigation of lsrE's potential role in the Jekyll and Hyde characteristics of S. paratyphi B strains

    • Comparative analysis between systemic pathovar (SPV) and enteric pathovar (EPV) to determine if lsrE contributes to these distinct disease phenotypes

    • Assessment of whether lsrE functions alongside established virulence factors like SopE1 and AvrA

  • Host-Pathogen Interface Studies:

    • Examination of lsrE expression patterns during different stages of infection

    • Investigation of whether lsrE activity modifies host-derived substrates

    • Analysis of potential immunomodulatory effects mediated by lsrE or its enzymatic products

  • Diagnostic and Therapeutic Applications:

    • Development of lsrE-based diagnostic approaches to differentiate between invasive and non-invasive S. paratyphi B strains

    • Exploration of lsrE as a potential therapeutic target, particularly if its function proves critical for pathogenesis

    • Structure-based drug design targeting lsrE if validated as a virulence factor

  • Evolutionary and Ecological Perspectives:

    • Comprehensive phylogenetic analysis of lsrE across Salmonella strains and related enterobacteria

    • Investigation of horizontal gene transfer events involving lsrE

    • Examination of lsrE's role in environmental persistence and transmission dynamics

  • Systems Biology Integration:

    • Multi-omics approaches (transcriptomics, proteomics, metabolomics) to position lsrE within the broader cellular networks of S. paratyphi B

    • Network analysis to identify functional relationships with established virulence systems

    • Mathematical modeling of metabolic pathways involving lsrE to predict physiological impacts

These research directions, pursued systematically, would significantly enhance our understanding of lsrE's biological significance and potentially reveal new strategies for combating Salmonella paratyphi B infections, which remain a significant public health concern worldwide .

How might advanced technologies like CRISPR-Cas9 or single-cell analysis be applied to study lsrE function?

Advanced technologies offer unprecedented opportunities to investigate lsrE function with precision and contextual depth. The following methodological approaches leverage cutting-edge techniques to address key questions about this putative epimerase:

  • CRISPR-Cas9 Applications:

    • Precise Genetic Manipulation:

      • Generate scarless deletions, point mutations, or regulatory element modifications in lsrE with minimal polar effects

      • Create conditional knockdowns using CRISPRi approaches to study essential functions

      • Implement base editing to introduce specific amino acid substitutions at catalytic sites

    • High-Throughput Functional Genomics:

      • Perform CRISPR screens to identify genetic interactions with lsrE

      • Create saturating mutagenesis libraries of lsrE to comprehensively map structure-function relationships

      • Implement CRISPRa approaches to study effects of lsrE overexpression

  • Single-Cell Technologies:

    • Single-Cell RNA Sequencing:

      • Profile transcriptional heterogeneity in lsrE expression during infection

      • Identify subpopulations of bacteria with distinct lsrE activity states

      • Correlate lsrE expression patterns with virulence gene expression at single-cell resolution

    • Single-Cell Metabolomics:

      • Detect metabolic consequences of lsrE activity at individual cell level

      • Identify cell-to-cell variability in substrate utilization or product formation

    • Time-Lapse Microscopy with Reporters:

      • Monitor lsrE expression dynamics in real-time during infection processes

      • Correlate expression with cellular behaviors like division rate or invasion

  • Spatial Technologies:

    • Spatial Transcriptomics:

      • Map lsrE expression within infected tissues to understand spatial regulation

      • Correlate expression with microenvironmental factors

    • Super-Resolution Microscopy:

      • Track lsrE localization within bacterial cells with nanometer precision

      • Identify potential interaction partners through co-localization studies

  • Protein Structure and Interaction Approaches:

    • Cryo-EM and AlphaFold Integration:

      • Combine experimental cryo-EM data with AI-predicted structures to develop comprehensive structural models

      • Predict substrate binding modes and catalytic mechanisms

    • Proximity Labeling Proteomics:

      • Identify lsrE interaction partners in living cells using BioID or APEX2 approaches

      • Map the dynamic interactome under different infection conditions

  • Advanced Infection Models:

    • Organ-on-Chip Technologies:

      • Study lsrE function in microfluidic devices mimicking human intestinal or systemic environments

      • Analyze host-pathogen interactions with precise control of environmental parameters

    • Intravital Microscopy:

      • Track lsrE-expressing bacteria during real-time infection progression in animal models

      • Correlate expression with tissue tropism and dissemination patterns

These cutting-edge approaches provide unprecedented resolution and precision for investigating lsrE function, potentially revealing new insights into its role in Salmonella paratyphi B biology and pathogenesis that would be unattainable with conventional methods.

What are the key considerations for researchers beginning work with lsrE in their laboratories?

Researchers initiating studies on lsrE should consider the following practical recommendations to establish successful experimental workflows:

  • Protein Source and Quality Considerations:

    • Commercial recombinant lsrE is available with product codes like CSB-CF430455STF, expressed as a full-length protein (254 amino acids) with an N-terminal His-tag

    • Verify protein quality through SDS-PAGE and western blotting before experimental use

    • Consider generating your own expression constructs if specific tags or modifications are required

    • Implement strict quality control protocols for each new protein batch

  • Storage and Handling Best Practices:

    • Store stock protein at -80°C for maximum stability

    • Prepare single-use aliquots immediately upon receipt to avoid freeze-thaw cycles

    • For short-term work, maintain working aliquots at 4°C for no more than one week

    • When using lyophilized protein, reconstitute in appropriate buffers and verify activity

  • Experimental Design Considerations:

    • Include comprehensive controls in all experiments:

      • Negative controls (heat-inactivated enzyme, buffer-only)

      • Positive controls (well-characterized related enzymes)

    • Design experiments to test multiple potential substrates, as the natural substrate remains putative

    • Consider the potential membrane association of lsrE when designing purification and activity assays

  • Technical Expertise and Equipment Requirements:

    • Develop expertise in protein biochemistry and enzyme kinetics

    • Ensure access to analytical equipment for carbohydrate analysis (HPLC, MS)

    • Consider collaborations for specialized structural studies if not available in-house

  • Contextual Research Recommendations:

    • Thoroughly review literature on Salmonella paratyphi B pathogenicity mechanisms

    • Understand the distinct characteristics of systemic and enteric pathovars

    • Consider the broader metabolic and virulence networks that may involve lsrE

  • Pathway to Impactful Research:

    • Focus initial studies on definitively establishing enzymatic function

    • Progress to biological context investigations (gene expression, knockout phenotypes)

    • Advance to host-pathogen interaction studies only with well-characterized strains and mutants

  • Biosafety Considerations:

    • While recombinant lsrE protein itself presents minimal biosafety concerns, work with live Salmonella paratyphi B requires appropriate biosafety level containment

    • Establish proper protocols for handling potentially infectious materials if moving to bacterial studies

Following these recommendations will help researchers establish productive and scientifically rigorous investigations of lsrE, addressing the current knowledge gaps while building on established information about this putative epimerase.

What are the most significant unresolved questions about lsrE that future research should prioritize?

Despite the available information on recombinant lsrE protein, several critical knowledge gaps remain that should be prioritized in future research. These unresolved questions represent significant opportunities for advancing our understanding of Salmonella paratyphi B biology and pathogenesis:

  • Definitive Substrate Identification:

    • What is the natural substrate of this putative epimerase?

    • Does lsrE exhibit narrow substrate specificity or can it act on multiple related compounds?

    • How does substrate specificity compare between lsrE proteins from different S. paratyphi B pathovars?

    This fundamental question underlies all other aspects of lsrE research and should be addressed through systematic biochemical approaches .

  • Biological Function in Salmonella Metabolism:

    • What metabolic pathway(s) incorporate lsrE activity?

    • Is lsrE essential for specific growth conditions or host environments?

    • How is lsrE expression regulated in response to environmental signals?

    Understanding the metabolic context is crucial for interpreting phenotypic effects of lsrE manipulation .

  • Role in Virulence and Pathogenicity:

    • Does lsrE contribute to the distinctive disease phenotypes of different S. paratyphi B pathovars?

    • Is lsrE activity required for specific stages of infection (intestinal colonization, systemic spread)?

    • Does lsrE interact with established virulence factors like SopE1 or AvrA?

    These questions connect lsrE to the clinically relevant aspects of Salmonella paratyphi B infections .

  • Structural Determinants of Function:

    • What is the three-dimensional structure of lsrE?

    • Which amino acid residues constitute the active site?

    • How does the transmembrane nature of the protein influence its function?

    Structural insights would facilitate mechanistic understanding and potential inhibitor development .

  • Evolutionary Significance:

    • How conserved is lsrE across Salmonella lineages?

    • Did lsrE play a role in the divergence of systemic and enteric pathovars?

    • Are there functional homologs in other enteric pathogens?

    Evolutionary perspectives could reveal the historical importance of lsrE in Salmonella adaptation .

  • Diagnostic and Therapeutic Potential:

    • Could lsrE characteristics serve as biomarkers for distinguishing between pathovars?

    • Is lsrE a viable target for antimicrobial development?

    • Could inhibition of lsrE attenuate virulence without imposing strong selective pressure?

These prioritized research questions address fundamental gaps in our understanding while connecting basic science to potential applications in diagnosing and treating Salmonella paratyphi B infections, which remain a significant global health challenge .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.