Recombinant Salmonella paratyphi B Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Salmonella paratyphi B Spermidine Export Protein MdtI (mdtI)

Recombinant Salmonella paratyphi B Spermidine export protein MdtI (mdtI) is a protein derived from Salmonella enterica serovar Paratyphi B involved in multiple drug resistance (MDR) . MdtI is a spermidine export protein. Spermidine is a polyamine with roles in cell growth and proliferation . MdtI likely functions to transport spermidine across the cell membrane .

Molecular Cloning and Characterization

The rma gene of S. enterica serovar Paratyphi B, which encodes the Rma protein, causes an MDR phenotype in E. coli . The Rma protein shares significant sequence identity (75 to 88%) with the RamA proteins of several other gram-negative bacteria, which have previously been reported to cause the MDR phenotype in E. coli . The genes rma and roxA should be considered identical since their derived amino acid sequences are identical .

Role in Multiple Drug Resistance

Overexpression of Rma causes MDR in E. coli . Nucleotide sequences of the rma structural gene and its putative regulatory region are identical between S. enterica serovar Paratyphi B mutant M95 with MDR and its parent strain, suggesting that the MDR phenotype results from overexpression of the rma gene and raising the possibility that the phenotype of M95 is the result of a mutation that causes the induction of rma on the chromosome . Such a mutation could be in a cognate regulatory protein that is yet to be identified .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdtI; SPAB_01830; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
mdtI
Target Protein Sequence
MQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA
Uniprot No.

Target Background

Function
Catalyzes spermidine excretion.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Spermidine export protein MdtI and what is its primary function in Salmonella paratyphi B?

The Spermidine export protein MdtI is a membrane protein that functions as part of a spermidine excretion complex in Salmonella paratyphi B. It belongs to the small multidrug resistance (SMR) family of drug exporters. MdtI works in conjunction with MdtJ to form the MdtJI complex, which is responsible for exporting spermidine from bacterial cells . This export mechanism is crucial for maintaining cellular homeostasis by preventing toxic accumulation of spermidine within the bacterial cell. The protein consists of 109 amino acids and is primarily involved in polyamine transport across the cell membrane .

How does the MdtJI complex protect bacterial cells from spermidine toxicity?

The MdtJI complex protects bacterial cells from spermidine toxicity through several mechanisms:

  • Active export: The complex actively transports excess spermidine out of the cell, preventing its intracellular accumulation to toxic levels.

  • Inducible expression: Studies have shown that mdtJI mRNA levels increase in response to elevated spermidine concentrations, suggesting that the complex forms part of an adaptive response to polyamine stress .

  • Efficient excretion: When bacterial cells are cultured in the presence of high spermidine concentrations (2 mM), those expressing functional MdtJI demonstrate significantly lower intracellular spermidine content compared to cells lacking this complex .

Research has demonstrated that both components (MdtJ and MdtI) are necessary for recovery from spermidine-induced growth inhibition and cellular toxicity. Neither protein alone is sufficient to confer protection .

Which specific amino acid residues are critical for MdtI function and how were they identified?

Research has identified several key amino acid residues in MdtI that are critical for its spermidine export activity. These residues include:

PositionAmino AcidFunctional Significance
Glu5Glutamic acidInvolved in substrate recognition/binding
Glu19Glutamic acidContributes to transport activity
Asp60Aspartic acidCrucial for substrate translocation
Trp68TryptophanImportant for protein structure/substrate interaction
Trp81TryptophanCritical for transport activity

These residues were identified through site-directed mutagenesis studies where each amino acid was systematically replaced, and the resulting mutant proteins were assessed for their ability to confer spermidine resistance and export activity . The experimental approach involved creating point mutations in the mdtI gene, expressing the mutant proteins in E. coli strains deficient in spermidine acetyltransferase (which would otherwise metabolize spermidine), and measuring spermidine export efficiency and cellular toxicity.

What is the proposed mechanism of spermidine transport by the MdtJI complex?

The MdtJI complex functions as a heterodimer or heteromultimer that creates a pore or channel through which spermidine is transported across the bacterial membrane. Based on experimental evidence and structural analysis, the following mechanism has been proposed:

  • Binding: Negatively charged residues (particularly glutamic and aspartic acids) in both MdtI and MdtJ interact with the positively charged polyamine spermidine.

  • Conformational change: Upon substrate binding, the protein complex undergoes a conformational change.

  • Translocation: The substrate is moved through the transport channel formed by the complex.

  • Release: Spermidine is released to the extracellular environment.

The aromatic residues (particularly tryptophans) in both proteins appear to be involved in maintaining the structural integrity of the complex and possibly in creating a hydrophobic pathway for substrate movement .

How does the expression of mdtJI mRNA change in response to varying spermidine levels?

Experimental studies have demonstrated that mdtJI mRNA levels exhibit a dose-dependent increase in response to elevated spermidine concentrations. When bacterial cells are exposed to increasing concentrations of exogenous spermidine (from 0.5 mM to 2 mM), there is a corresponding increase in mdtJI mRNA levels . This upregulation appears to be specific to spermidine and is part of the bacterial adaptive response to polyamine stress.

The regulation mechanism may involve:

  • A specific transcriptional regulator that senses spermidine levels

  • Direct interaction between spermidine and a repressor protein

  • Indirect effects on DNA topology that influence mdtJI promoter activity

This inducible expression pattern underscores the physiological role of MdtJI as a dedicated spermidine exporter rather than just a general multidrug resistance protein.

What are the optimal expression systems and conditions for recombinant MdtI production?

For efficient recombinant production of MdtI protein, the following expression system and conditions have proven effective:

ParameterRecommended ConditionRationale
Expression HostE. coliCompatible with membrane protein expression
VectorpET-based with N-terminal His-tagFacilitates purification and detection
InductionIPTG (0.5-1.0 mM)Controllable expression
Temperature18-25°C post-inductionReduces inclusion body formation
MediaTerrific Broth or LB with glycerolEnhances membrane protein folding
Additives1% glucose during growth phaseReduces basal expression

The successful expression strategy involves:

  • Transformation of the construct into an appropriate E. coli strain (BL21(DE3) or C41/C43)

  • Growth at 37°C until OD600 reaches 0.6-0.8

  • Temperature reduction to 18-25°C prior to induction

  • Induction with IPTG and continued expression for 16-20 hours

  • Harvesting cells and membrane fraction isolation

For the recombinant Salmonella paratyphi B MdtI protein, expression in E. coli with an N-terminal His-tag has been reported, yielding protein with greater than 90% purity as determined by SDS-PAGE .

What purification strategies are most effective for MdtI protein?

Purification of MdtI presents challenges typical of membrane proteins. The following step-wise protocol has proven effective:

  • Membrane isolation: After cell disruption (typically by sonication or French press), the membrane fraction is isolated by ultracentrifugation.

  • Solubilization: Membranes are solubilized using an appropriate detergent. Common effective detergents include:

    • n-Dodecyl β-D-maltoside (DDM) at 1%

    • n-Octyl β-D-glucopyranoside (OG) at 2%

    • Digitonin at 1%

  • Affinity chromatography: For His-tagged MdtI, immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins is effective. Washing with low concentrations of imidazole (20-40 mM) removes non-specifically bound proteins, followed by elution with higher imidazole concentrations (250-500 mM).

  • Size exclusion chromatography: This step separates the protein of interest from aggregates and other contaminants.

  • Concentration and storage: The purified protein can be concentrated using centrifugal filters with appropriate molecular weight cutoffs. For storage, addition of 6% trehalose in Tris/PBS-based buffer at pH 8.0 has been reported as effective .

After purification, the recombinant protein should be stored at -20°C/-80°C with recommendations to avoid repeated freeze-thaw cycles. For working aliquots, storage at 4°C for up to one week is advised .

How can the activity of MdtI be measured in vitro and in vivo?

Several complementary approaches can be used to measure MdtI activity:

In vivo methods:

  • Growth rescue assay: Measure growth of a spermidine acetyltransferase-deficient E. coli strain in the presence of toxic spermidine concentrations, with and without MdtI expression .

  • Radio-labeled spermidine uptake/efflux: Measure the accumulation or efflux of radio-labeled spermidine (typically 14C or 3H-labeled) in cells expressing MdtI compared to control cells.

  • Fluorescent spermidine analogs: Monitor export of fluorescently labeled spermidine analogs using fluorescence microscopy or flow cytometry.

In vitro methods:

  • Proteoliposome-based transport assays: Reconstitute purified MdtI (preferably with MdtJ) into liposomes and measure spermidine transport across the liposomal membrane.

  • Membrane vesicle transport assays: Prepare inside-out membrane vesicles from cells expressing MdtI and measure ATP-dependent spermidine transport.

  • Electrophysiological measurements: Using planar lipid bilayers or patch-clamp techniques to directly measure transport activity.

The choice of method depends on the specific research question, available equipment, and desired level of detail in understanding transport kinetics.

How can site-directed mutagenesis be used to study MdtI structure-function relationships?

Site-directed mutagenesis is a powerful approach for investigating structure-function relationships in MdtI. The following methodology has proven effective:

  • Target selection: Based on sequence conservation, structural predictions, and previous findings, select residues potentially involved in:

    • Substrate binding (charged residues like Glu5, Glu19, Asp60)

    • Transport pathway formation (aromatic residues like Trp68, Trp81)

    • Protein-protein interaction (interface between MdtI and MdtJ)

    • Conformational changes (flexible regions or hinges)

  • Mutation strategy:

    • Conservative substitutions (e.g., Glu→Asp) to probe the importance of specific chemical properties

    • Non-conservative substitutions (e.g., Glu→Ala) to completely remove side chain functionality

    • Cysteine substitutions for subsequent chemical modification or cross-linking studies

  • Functional assays:

    • Spermidine resistance assays in vivo

    • Transport activity measurements using methods described in section 3.3

    • Protein expression and stability analysis

Previous research has identified key functional residues in MdtI including Glu5, Glu19, Asp60, Trp68, and Trp81 . These residues were found to be involved in the spermidine excretion activity of the MdtJI complex.

What approaches can be used to study the MdtI-MdtJ interaction?

Understanding the interaction between MdtI and MdtJ is crucial for elucidating the functional mechanism of the complex. Several complementary techniques can be employed:

  • Co-immunoprecipitation: Using antibodies against one component (or a tag) to pull down the complex and identify the interacting partner.

  • Bacterial two-hybrid system: Modified for membrane proteins to detect protein-protein interactions in a cellular context.

  • FRET (Förster Resonance Energy Transfer): Using fluorescently labeled MdtI and MdtJ to detect proximity and interaction in live cells.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry to identify interacting regions.

  • Co-purification: Tandem affinity purification using differently tagged versions of MdtI and MdtJ.

  • Structural studies: Techniques such as X-ray crystallography or cryo-EM of the co-purified complex.

  • Computational modeling: In silico prediction of interaction interfaces based on sequence and structural information.

Research has established that both MdtI and MdtJ are necessary for recovery from spermidine toxicity, strongly suggesting that they function together as a complex .

How do different polyamines affect MdtI expression and activity?

While MdtI has been primarily characterized as a spermidine exporter, its interaction with other polyamines is an important area of investigation:

PolyamineEffect on mdtJI ExpressionTransport ActivityCellular Protection
SpermidineStrong inductionHigh activitySignificant protection
PutrescineModerate induction*Limited activity*Partial protection*
SpermineWeak induction*Minimal activity*Limited protection*
CadaverineMinimal effect*Not detected*No significant protection*

*Note: These are typical patterns based on similar transport systems; specific data for MdtI may vary and requires experimental verification.

Research methodologies to investigate polyamine specificity include:

  • Competitive transport assays using different labeled polyamines

  • Growth inhibition studies with various polyamines

  • Expression analysis of mdtJI mRNA in response to different polyamines

  • Binding studies using purified protein and different polyamines

Understanding the polyamine specificity profile of MdtI has implications for bacterial physiology and potential antimicrobial strategies targeting polyamine homeostasis.

How does MdtI from Salmonella paratyphi B compare to homologs in other bacterial species?

MdtI belongs to the small multidrug resistance (SMR) family of transporters, which are widely distributed across bacterial species. Comparative analysis reveals:

SpeciesIdentity to S. paratyphi B MdtIKey Functional DifferencesEvolutionary Implications
E. coli~95%*Similar functionalityRecent common ancestor
S. Typhi~98%*Nearly identical functionClose evolutionary relationship
S. Typhimurium~97%*Similar functionalityRecent divergence
Klebsiella spp.~75%*Possibly broader substrate rangeMore distant relationship
Pseudomonas spp.~45%*Different substrate specificityDistant evolutionary relationship

*Approximate values based on typical conservation patterns for membrane transporters; exact values require sequence alignment.

The high conservation of key functional residues (including Glu5, Glu19, Asp60, Trp68, and Trp81) across species suggests evolutionary pressure to maintain spermidine export function. Variations in non-critical regions may reflect adaptation to different cellular environments or fine-tuning of transport kinetics.

Comparative genomics approaches can reveal:

  • Co-evolution of MdtI with MdtJ across species

  • Correlation between MdtI sequence variations and bacterial habitat or pathogenicity

  • Potential horizontal gene transfer events involving the mdtI gene

What are the challenges in crystallizing MdtI for structural studies?

Membrane proteins like MdtI present significant challenges for structural determination. Key challenges include:

  • Protein stability: Membrane proteins often denature when removed from their native lipid environment.

  • Detergent selection: Finding a detergent that maintains protein stability and allows crystallization requires extensive screening.

  • Protein-protein contacts: Membrane proteins have limited hydrophilic surfaces for crystal contacts.

  • Conformational heterogeneity: Transport proteins often exist in multiple conformational states.

  • Expression yields: Obtaining sufficient quantities of pure, homogeneous protein is difficult.

Strategies to overcome these challenges include:

  • Use of protein fusion partners (e.g., T4 lysozyme) to increase hydrophilic surfaces

  • Antibody fragment co-crystallization to stabilize specific conformations

  • Lipidic cubic phase crystallization methods

  • Nanodiscs or amphipols as alternatives to traditional detergents

  • Limited proteolysis to remove flexible regions that may impede crystallization

While the crystal structure of MdtI has not been reported, structural insights might be inferred from related SMR family proteins that have been crystallized, such as EmrE from E. coli.

How can contradictory results in MdtI functional studies be reconciled?

When faced with contradictory results in MdtI functional studies, researchers should consider:

  • Experimental context differences:

    • Expression systems (native vs. recombinant)

    • Genetic background of host strains

    • Growth conditions and media composition

  • Methodological variations:

    • Transport assay protocols (in vivo vs. in vitro)

    • Protein tagging strategies affecting function

    • Detergent selection for in vitro studies

  • Data analysis approaches:

    • Statistical methods applied

    • Controls included

    • Normalization procedures

  • Reconciliation strategies:

    • Direct side-by-side comparison using standardized protocols

    • Meta-analysis of multiple studies

    • Collaboration between different research groups

    • Development of new experimental approaches that address limitations

For example, discrepancies in spermidine export activity might result from differences in the MdtJ:MdtI stoichiometry in different expression systems, or from the presence of endogenous transporters in some bacterial strains but not others.

What statistical approaches are appropriate for analyzing MdtI activity data?

Appropriate statistical analysis of MdtI activity data depends on the experimental design:

  • For comparing activity between wild-type and mutant proteins:

    • t-tests for pairwise comparisons

    • ANOVA with post-hoc tests for multiple comparisons

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) if data is not normally distributed

  • For transport kinetics:

    • Non-linear regression for determining Km and Vmax

    • Comparison of kinetic parameters using extra sum-of-squares F test

    • Confidence interval calculation for kinetic parameters

  • For dose-response experiments:

    • EC50/IC50 determination using 4-parameter logistic regression

    • Comparison of curves using extra sum-of-squares F test

  • For time-course experiments:

    • Repeated measures ANOVA

    • Mixed-effects models for handling missing data points

  • For quality control:

    • Grubbs' test for identifying outliers

    • Shapiro-Wilk test for normality

    • Levene's test for homogeneity of variance

Sample size determination should consider statistical power analysis to ensure sufficient sensitivity to detect biologically meaningful differences in MdtI activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.