Recombinant Salmonella paratyphi B Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Functional Role in Spermidine Export

MdtJ partners with MdtI to form the MdtJI complex, a small multidrug resistance (SMR) family exporter . Key functional insights:

  • Substrate Specificity: Exclusively exports spermidine, not putrescine or spermine .

  • Mechanism: Reduces intracellular spermidine toxicity by enhancing excretion, with critical residues (Tyr⁴, Trp⁵, Glu¹⁵ in MdtJ) identified for activity .

  • Regulation: mdtJI mRNA expression is upregulated by spermidine accumulation, indicating feedback-driven transport .

Association with Multidrug Resistance

MdtJ is linked to MDR phenotypes in Salmonella through genomic studies:

  • Gene Context: The mdtJ locus (SPAB_01831) neighbors rma, a transcriptional regulator implicated in antibiotic resistance .

  • Effector Synergy: Overexpression of rma in E. coli upregulates TolC (an efflux pump component) and represses OmpF (a porin), mirroring MDR adaptations .

Immunological and Vaccine Applications

While not directly tested for vaccines, recombinant Salmonella proteins like the outer membrane protein rT2544 (studied in S. Typhi) demonstrate:

  • Antibody Responses: Induces IgG/IgA plasma cells and memory B/T cells .

  • Cytotoxic T Cells: Generates IFN-γ-producing CTLs capable of lysing antigen-presenting cells . This suggests potential for MdtJ in similar immunological studies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdtJ; SPAB_01831; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Target Names
mdtJ
Target Protein Sequence
MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is mdtJ and what is its primary biological function?

MdtJ is a component of the MdtJI complex that functions as a spermidine excretion system in bacteria. This protein belongs to the small multidrug resistance (SMR) family of drug exporters. The complex plays a critical role in maintaining polyamine homeostasis by exporting excess spermidine from cells, preventing the toxicity associated with spermidine overaccumulation. Both mdtJ and mdtI genes are necessary for protection against spermidine toxicity, as demonstrated in E. coli strains deficient in spermidine acetyltransferase .

What is the molecular structure of the mdtJ protein?

The mdtJ protein from Salmonella paratyphi A consists of 120 amino acids with the sequence: MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAYALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKGAARATI . As a membrane protein in the SMR family, mdtJ contains multiple transmembrane domains that form part of the efflux channel. Functional studies have identified specific amino acid residues (Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82) that are essential for the spermidine export activity of mdtJ .

How is mdtJ expression regulated in bacterial systems?

Research indicates that mdtJI mRNA levels increase in response to spermidine exposure, suggesting autoregulation based on substrate availability . Additionally, temperature plays a significant role in regulation, as demonstrated in E. coli O157:H7, where mdtJI expression is elevated at refrigeration temperatures (4°C) compared to 37°C, indicating a potential role in cold adaptation mechanisms . This temperature-dependent expression suggests mdtJ may be integrated into broader stress response pathways.

What homology exists between mdtJ proteins from different bacterial species?

While specific homology data between Salmonella paratyphi B and other species was not directly provided in the search results, functional studies indicate conservation of mdtJ's role across different bacterial species. The mdtJ protein has been characterized in both Salmonella species and E. coli, with similar functional properties observed. Comparative genomic analysis would likely reveal conserved domains essential for spermidine transport activity while highlighting species-specific adaptations.

What is the mechanistic basis for mdtJ-mediated spermidine export?

The MdtJI complex functions through specific amino acid residues that create a substrate transport pathway. In MdtJ, the critical residues include Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82, which likely form part of the substrate binding pocket or channel . Similarly, complementary residues in MdtI (Glu5, Glu19, Asp60, Trp68, and Trp81) are essential for the complex's functionality. The heterodimeric arrangement of these proteins creates a spermidine-specific transport channel that facilitates export against concentration gradients. This organization allows the complex to catalyze the excretion of spermidine from cells, thereby reducing intracellular spermidine concentrations to non-toxic levels.

How does the mdtJI complex interact with other cellular systems?

While direct interactome data was not present in the search results, the functional context suggests significant interactions with polyamine metabolic pathways. The mdtJI system appears to complement metabolic detoxification mechanisms like spermidine acetyltransferase, providing cells with multiple strategies for maintaining polyamine homeostasis . Additionally, the upregulation of mdtJI at lower temperatures suggests integration with cold shock response pathways . This connection to temperature adaptation mechanisms indicates potential interactions with other stress response systems, possibly forming part of a broader adaptive network that helps bacteria survive in changing environmental conditions.

What approaches can be used to study structure-function relationships in mdtJ?

Advanced structural biology approaches can elucidate the three-dimensional organization of mdtJ and its complexation with mdtI. Site-directed mutagenesis targeting the identified key residues (Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82) provides insights into specific functional domains . Researchers can employ protein crystallography, cryo-electron microscopy, or computational modeling to predict structural features. Design of Experiments (DoE) approaches can systematically explore the effects of multiple mutations simultaneously, enabling more efficient optimization of experimental conditions while accounting for potential non-linear interactions between mutations .

How does mdtJ contribute to bacterial stress responses and pathogenicity?

MdtJ appears to be involved in multiple stress adaptation mechanisms. Its increased expression at refrigeration temperatures suggests a role in cold adaptation . Since polyamines like spermidine are important for protecting cells against various stresses (including oxidative stress and antibiotic exposure), the mdtJI system likely contributes to broader stress resilience. In pathogenic strains like E. coli O157:H7, this system may facilitate adaptation to different host environments and environmental reservoirs, potentially contributing to persistence in food production environments and transmission cycles.

What expression systems are optimal for producing recombinant mdtJ protein?

Based on available research, E. coli expression systems have been successfully employed to produce recombinant Salmonella paratyphi A mdtJ protein with an N-terminal His tag . As mdtJ is a membrane protein, specialized expression strategies may be necessary, including:

Table 1: Optimization Parameters for mdtJ Expression

ParameterRecommendationRationale
Expression HostE. coli strains designed for membrane proteins (C41/C43)Better tolerance for membrane protein overexpression
InductionLow IPTG concentrations (0.1-0.5 mM)Prevents inclusion body formation
Growth Temperature16-25°C post-inductionSlows expression rate, improves folding
Media Supplements5-10% glycerolStabilizes membrane proteins
Extraction BufferDetergent screening panelIdentifies optimal solubilization conditions

When applying DoE approaches to expression optimization, researchers should consider these variables as continuous factors that can be systematically varied to identify optimal conditions for mdtJ expression .

What purification strategies are most effective for mdtJ?

Purification of His-tagged mdtJ can be achieved through affinity chromatography, resulting in greater than 90% purity as determined by SDS-PAGE . The following methodological considerations are important:

  • Initial solubilization requires careful detergent selection, typically using mild detergents like DDM or LMNG

  • Affinity purification using Ni-NTA or TALON resins with detergent-containing buffers

  • Size exclusion chromatography as a polishing step to separate monomeric/dimeric forms

  • Storage in stabilizing buffer containing 6% trehalose at pH 8.0

  • Aliquoting to avoid repeated freeze-thaw cycles that may disrupt protein structure

For functional studies, co-expression with mdtI should be considered, as both proteins are necessary for complete functional activity .

How can researchers accurately assess mdtJ functional activity?

Functional assessment of mdtJ requires consideration of its native role in spermidine export. Based on published methodologies, researchers can employ:

  • Complementation assays in spermidine-sensitive bacterial strains (e.g., spermidine acetyltransferase-deficient strains)

  • Direct measurement of spermidine excretion using radiolabeled or fluorescently tagged spermidine

  • Cell toxicity and growth inhibition assays in the presence of excess spermidine

  • Measurement of cellular spermidine content in cells expressing mdtJ/mdtI versus controls

  • mRNA expression analysis to assess upregulation in response to spermidine exposure

For quantitative assessments, researchers should normalize activity measurements using established reference standards, facilitating cross-laboratory comparisons .

How can Design of Experiments (DoE) approaches enhance mdtJ research efficiency?

DoE methodologies can significantly improve the efficiency of mdtJ research by enabling systematic exploration of multiple experimental variables simultaneously. Unlike traditional one-factor-at-a-time approaches, DoE allows researchers to:

  • Screen numerous factors affecting mdtJ expression or activity with minimal experimental iterations

  • Identify non-linear interactions between variables that might be missed in conventional experiments

  • Optimize expression conditions by creating mathematical models of the experimental space

  • Refine structural modifications through fractional factorial designs that explore mutation combinations efficiently

When implementing DoE for mdtJ research, researchers should categorize variables as either categorical (e.g., strain type, vector design) or continuous (e.g., temperature, inducer concentration, pH), and select appropriate experimental designs based on their objectives . For initial screening, Plackett-Burman or definitive screening designs would be appropriate, while response surface methodology could refine optimization conditions once significant factors are identified.

How does mdtJ function differ between Salmonella paratyphi and E. coli?

While both Salmonella and E. coli mdtJ proteins function in spermidine export, there appear to be species-specific adaptations. In E. coli O157:H7, mdtJI expression is significantly affected by temperature, with higher expression at refrigeration temperatures (4°C) compared to 37°C . This temperature-dependent regulation suggests adaptation to environmental survival. The amino acid sequence of Salmonella paratyphi A mdtJ (120 amino acids) likely has structural similarities to E. coli mdtJ, with conservation of the key functional residues identified in E. coli (Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82) .

What is known about the evolutionary conservation of mdtJ across bacterial species?

While detailed evolutionary analysis was not provided in the search results, the functional characterization of mdtJ in both Salmonella and E. coli suggests evolutionary conservation of this spermidine export mechanism. The conservation of key functional residues would be expected in core domains involved in substrate recognition and transport. Evolutionary pressure to maintain polyamine homeostasis likely contributes to the preservation of this system across enterobacteria, while potentially allowing for regulatory divergence to accommodate different ecological niches.

How does the mdtJI complex compare to other bacterial polyamine transport systems?

The mdtJI complex represents one of several polyamine transport systems in bacteria. While the search results don't directly compare mdtJI to other systems, its specific role in spermidine export distinguishes it from polyamine uptake transporters. The induction of mdtJI by spermidine indicates a specialized role in preventing toxicity from excess spermidine . Other bacterial polyamine transporters may have different substrate specificities, directionality (import vs. export), or regulatory mechanisms. The integration of mdtJI with stress response pathways, particularly cold adaptation , suggests evolution of specialized regulatory mechanisms beyond simple polyamine homeostasis.

How can mdtJ be utilized in metabolic engineering applications?

MdtJ presents several opportunities for metabolic engineering applications:

  • Polyamine production optimization: Engineering mdtJ expression could enhance production strains by preventing toxic accumulation of intermediates

  • Stress resistance engineering: Controlled expression of mdtJI could enhance bacterial survival in industrial fermentation conditions

  • Biosensor development: The spermidine-responsive promoter controlling mdtJI could be adapted for biosensor applications

  • Protein export systems: Understanding the transport mechanism of mdtJ might inform the design of export systems for recombinant proteins

Applying DoE approaches to these applications would allow systematic optimization of mdtJ-based systems through efficient exploration of genetic and environmental parameters .

What emerging technologies might advance our understanding of mdtJ function?

Several cutting-edge technologies could substantially advance mdtJ research:

  • Cryo-electron microscopy: Revealing the precise structure of the mdtJI complex in membrane environments

  • Single-molecule transport assays: Directly visualizing spermidine transport through reconstituted mdtJI channels

  • Machine learning approaches: Extending beyond traditional DoE to model complex interactions between genetic and environmental factors

  • Genome-wide interaction screens: Identifying genetic interactions between mdtJI and other cellular systems

  • Advanced protein engineering: Creating modified versions of mdtJ with altered substrate specificity or regulatory properties

What are the current knowledge gaps regarding mdtJ that warrant further investigation?

Despite significant progress in understanding mdtJ function, several important knowledge gaps remain:

  • The precise 3D structure of the mdtJI complex and the conformational changes during transport

  • Complete regulatory networks controlling mdtJ expression beyond spermidine and temperature

  • Potential roles of mdtJ in other stress responses beyond cold adaptation

  • Substrate specificity profiles across different bacterial species

  • Potential interactions between mdtJ and host factors during infection

  • Integration of mdtJ with broader polyamine metabolic networks

Addressing these gaps will require interdisciplinary approaches combining structural biology, systems biology, and genetic engineering. The application of DoE methodologies could significantly accelerate progress by enabling more efficient exploration of these complex biological questions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.